KEGG   Malus domestica (apple): 103452895Help
Entry
103452895         CDS       T03194                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 4-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00520  Amino sugar and nucleotide sugar metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103452895
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     103452895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-GeneID: 103452895
NCBI-ProteinID: XP_008390646
Position
Unknown
AA seq 444 aa AA seqDB search
MASSSDNLSLVHRTHHNQQIDQSQPFLEPQTNHKPPHSSTNPIRYMLREQRFIFVLIGVA
IAVFFFTTFLASNPLLESVHDPGLESGLGSDRPGIDLPANPTRRVLLETWNVGGKVPLGV
RKKNMRIVVTGGAGFVGSHLVDRLIARGDSVIVLDNFFTGRKENLAHHFGNPKFELIRHD
VVEPILLEVDQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSE
VYGDPLQHPQVESYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGLGIEVRIARIFNTYGP
RMCIDDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGNHVGPFNLG
NPGEFTMLELAQVVQDTIDPNAKIEFRPNTEDDPHKRKPDISKAKELLGWEPTVSLRKGL
PLMVTDFRQRIFGDSKDRDAGSAM
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagctccgataatctgtcattagttcacagaacccaccataatcaacaaatt
gaccaatcacaaccctttctcgaaccacaaaccaaccacaagcctccgcattcctccacc
aaccccattcgatacatgctccgcgagcagcgttttatcttcgtcctcattggcgtcgcc
atcgctgttttcttcttcaccaccttcctggcatcgaacccactattggaatccgttcac
gaccctggtctcgaatccggattaggttctgatcggccgggtattgatctcccggccaac
cctacccggagggtgctgttggagacgtggaatgtgggagggaaggtgccgctgggggtg
aggaagaagaacatgaggattgttgtgacgggtggggccgggttcgtggggagccacctc
gtggaccgtctgatcgcgagaggggacagcgtgatcgtgctggataatttttttaccggg
aggaaggagaacttggcgcaccacttcgggaacccgaagttcgagctgattcgacacgac
gtggtcgagccgatattgttggaggttgaccagatctaccacctcgcttgcccggcatcc
ccggtgcattacaagttcaatccggtcaagacaattaagacaaatgtggtgggaacactg
aacatgcttggactagcaaaaagggttggtgcacgcttcttgctgacaagcaccagtgag
gtttacggtgaccctttgcagcaccctcaggtcgagtcctactggggtaatgtcaacccc
atcggtgtaaggagctgctacgatgagggaaaacgcacagcagagactctgaccatggac
taccacagaggccttggcattgaggtgaggattgctcggattttcaacacttatggaccg
cgtatgtgcatcgatgatggtcgtgttgttagcaatttcgtagctcaggcattaaggaag
gagccattgacagtttatggagatggcaagcaaacccgaagtttccaatacgtttctgac
ttggtcgagggtctaatgcggctgatggaaggaaatcatgtaggccctttcaaccttggc
aaccctggcgaattcaccatgctagaacttgcccaggttgtgcaagacacaatagatcca
aatgcaaagatagagttcaggcccaacacagaggacgacccacacaagaggaagccggac
atttccaaggctaaggagcttctggggtgggagcccaccgtgtccctccgcaaggggctg
ccgctcatggttacagacttcaggcagcgtatttttggtgactctaaggatagagatgca
ggctccgctatgtaa

DBGET integrated database retrieval system