KEGG   Malus domestica (apple): 103454746Help
Entry
103454746         CDS       T03194                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00480  Glutathione metabolism
mdm00590  Arachidonic acid metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103454746
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103454746
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103454746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 103454746
NCBI-ProteinID: XP_008392568
Position
14
AA seq 171 aa AA seqDB search
MPSQPDEYPDGTIYEYTVKDVKGKDVDLSMYRGKVVMVVNVASQCGLTEENYTELNQLYQ
KYKDQGLEILAFPCNQFNAQEPGSNDQIQEFACTRFKTAFPIFNKIKVNGLNTAPLYKFL
KLGKWGFFGDDIQWNFAKFLVNKQGKPVGRYYPTTSPLSLQHDINRLLEAS
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgccaagccaacccgatgagtacccagacggaacaatttacgaatacactgtcaaggac
gttaagggaaaggatgtcgatctcagcatgtacaggggaaaggttgtgatggttgttaat
gttgcttcccaatgtggattgacggaggaaaattacacggagttgaatcaactatatcaa
aagtataaagatcaaggcttggagattctggcatttccgtgtaaccagtttaatgctcag
gaaccaggaagtaatgatcagattcaagagtttgcctgcactcgtttcaaaacagcattc
ccaatttttaacaagattaaagtaaacggccttaatactgctccgttgtacaagttcttg
aagttaggcaaatggggattcttcggagacgatatccagtggaactttgctaagtttctt
gtcaacaagcaaggaaaacctgtcggtcgttattacccaacaacttccccccttagcctt
cagcatgacataaacaggcttttggaagcctcgtga

DBGET integrated database retrieval system