KEGG   Malus domestica (apple): 103455055Help
Entry
103455055         CDS       T03194                                 

Definition
(RefSeq) autophagy-related protein 16-like
  KO
K17890  autophagy-related protein 16-1
Organism
mdm  Malus domestica (apple)
Pathway
mdm04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    103455055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdm04131]
    103455055
   03029 Mitochondrial biogenesis [BR:mdm03029]
    103455055
Membrane trafficking [BR:mdm04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    103455055
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    103455055
Mitochondrial biogenesis [BR:mdm03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    103455055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 ATG16 Nup160 eIF2A Cytochrom_D1 DUF2935 zf-C4H2 Fib_alpha
Motif
Other DBs
NCBI-GeneID: 103455055
NCBI-ProteinID: XP_008392873
Position
14
AA seq 509 aa AA seqDB search
MSQEEIAREAIKHALKALRRRHLAEEGAHAPAFIALSKPILHQGSEWKEKAENLEMELQQ
CYKAQSRLSEQLVVEVAESRTSKASLQEKEAAVANLQKELSEQRDECSQLAADLEEKVKA
LELVVSENKEIRAQLEEMSIRAKNAEAENKVLIDRWMLEKMKDAERLNEANALYEDMIER
LRASGLEKLARQQVDGVVRQSEEGAEYFLESTIPSTCKNRMPAHDGGCASILFEYNSGKL
ITGGQDGSIKMWDTNTGSLTRTLYGCIGSVLDLTITHDNRSIIAASSSNKLYAWDVNSGR
VRHTLTGHMDKVCAVDVSKFSSRHVVSAAYDRTIKVWDMQKGYCTNTIMFPKNCNALSFS
MDGQTICSGHVDGNLRLWDIEKGKLLSEVAAHSNAVTSISLSRNGNVILTSGRDNVHNLF
DMRSLEVCGTLRATGNRVASNWSRSCISPDDNYVAAGSADGCVYIWSISKADIVSTMKEH
TASVLCCSWSGHGKPLASADKNGIICTWT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaggaggagattgcgagggaagcaataaaacacgctctgaaggctcttcggcgg
cggcatttggcggaagaaggtgctcatgctccagctttcatcgctctttcgaagccaatt
cttcatcagggctcagaatggaaggagaaagcggagaatctggaaatggaacttcagcag
tgttacaaagcccaatctcggctgtccgagcaactcgtggtggaagtagcggagtccaga
acttcaaaagcttcacttcaagagaaagaggcagcagtggctaatcttcagaaggaatta
tctgaacaaagggatgaatgctctcaattagcggctgacttggaagagaaggttaaagct
ttggaattggttgtgagtgagaacaaggaaataagagcgcagctagaagaaatgtctatt
cgagctaagaacgctgaggccgaaaataaggtgttaattgaccgctggatgttggagaag
atgaaggatgcagaacgccttaacgaggcaaatgcactctatgaagatatgattgagcgg
ctgagggccagcggtttggagaaacttgctaggcagcaagtagatggtgttgtccgccaa
agtgaagaaggtgctgagtactttttggagtcaaccattccctccacatgcaagaatagg
atgcctgcccatgatggtggctgcgcttccatattatttgagtacaattcagggaaattg
attactggtggacaggatgggtccatcaaaatgtgggatacaaatactgggtcactaact
cgtacactctatggttgcattggttctgttctggatctcacgattactcatgataataga
tctatcattgcagcaagcagctctaacaaattgtatgcctgggatgttaactcggggagg
gttcgacatactctcactggccacatggataaagtgtgtgcagtagatgtcagcaaattc
tcaagccgccatgttgtgagtgcagcttatgatcgtaccataaaagtttgggatatgcag
aaaggttactgcaccaacacaatcatgttcccaaaaaactgcaatgctctgtcatttagc
atggatggacagaccatatgttctggccatgttgatggaaatcttcgtttgtgggatatt
gagaaaggaaaactcctcagtgaagtagctgcacactcaaatgctgttacatccatatct
ttgtcccgaaatggcaatgttatactgaccagtgggagagacaatgtccataatttgttt
gacatgcggtctctagaagtctgtggaacattaagagccacaggaaacagagtagcgtcg
aattggagtagatcctgtatcagtccagatgacaattacgttgctgctggatctgctgac
ggttgtgtgtatatttggtcaatatcgaaagctgacattgtgagcactatgaaggagcac
actgcatcggttctgtgttgttcatggagcgggcatggaaaacctctggcttctgcggac
aagaacggaatcatctgtacttggacgtga

DBGET integrated database retrieval system