KEGG   Malus domestica (apple): 103455209Help
Entry
103455209         CDS       T03194                                 

Definition
(RefSeq) uncharacterized protein LOC103455209 isoform X1
  KO
K06195  ApaG protein
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    103455209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR CBM49 DUF4354
Motif
Other DBs
NCBI-GeneID: 103455209
NCBI-ProteinID: XP_008393022
Position
14
AA seq 296 aa AA seqDB search
MHSLSLKVCSNCCPGTTRTCSPGRGSFGVANSEVRNLRVGSGHGDFGKSCRVVACAVERS
GGNEWSGSRSSSPSSGAGQKPSSFLSRSQSWALLKQQMEVASKSEDYEEAARIRDSLKLL
EEEEPVLWLRRRIKEAIAEERFEDAAKYRDELKEIAPYSFLKCSSDATTLGIRVQVRSVF
IEGRSQPSKGQHFFAYRIRITNNSDRPVQLLRRHWIITDANGKSENVWGIGVIGEQPVIL
PQTSFEYSSACPLSTPSGRMEGEFEMKHINRVSSQSFNVAIAPFALSILEDDIDTF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcattcattaagcctcaaagtctgcagtaattgctgtccggggacgacgaggacgtgt
tcgccggggcgggggagcttcggcgtcgcgaattcggaggtccggaacttgagagtcggg
tcggggcatggggatttcgggaaatcgtgtcgggtcgtggcgtgcgccgtggagaggagc
ggggggaatgagtggagtggaagtcggagttcgagtccgagttctggtgcgggtcagaaa
ccgagttcatttctgtctcggagtcagagctgggctttgttgaagcagcaaatggaggtc
gcgtcgaaatctgaggattacgaggaggcggcgaggatccgggactcgttgaagttgtta
gaagaggaggagccggttttgtggctccgaagaaggataaaggaggcaattgctgaagag
agatttgaggacgccgcgaaatatcgagatgagctaaaggaaattgccccttactctttc
ttgaaatgttcaagtgatgcaacaactttgggtattcgggtccaagttaggagtgtattc
atagagggcagaagtcagccttcgaaggggcaacacttttttgcatatagaatacgaatt
accaataactcagatcgtcctgttcaacttcttagaaggcattggattatcacggatgcc
aacggaaaatccgaaaatgtctgggggattggtgttattggtgaacagccagttattctt
cctcaaacgagttttgaatactcatcagcttgcccattaagcactcccagtggcagaatg
gaaggtgagtttgagatgaaacacatcaatagggtaagttcacaatcgtttaatgtggca
attgctccctttgccctctcgatattggaagatgacattgacaccttttga

DBGET integrated database retrieval system