KEGG   Malus domestica (apple): 108173900Help
Entry
108173900         CDS       T03194                                 

Definition
(RefSeq) MDIS1-interacting receptor like kinase 2-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdm01001]
    108173900
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108173900
Protein kinases [BR:mdm01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108173900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_8 LRR_4 LRR_1 LRR_6 Pkinase_fungal PIP49_C RIO1
Motif
Other DBs
NCBI-GeneID: 108173900
NCBI-ProteinID: XP_028962969
Position
8
AA seq 609 aa AA seqDB search
MLYGEISQKWGQCSQLKTLIIAGNNLTGSIPPEIVNADKIHELDLSSNHLVGTIPKGFGR
MTSLQKLMLNGNQLSSSIPSEFGLLVDLEYLDLSSNRFNGSIVTTLGDFPKMYHLNLSNN
HFSQGIPFKLEKLVQLNELDLSHNSLEGSIPPAISNMESLQTLNLSHNNLSGFIPSSIEG
MHGLLYVDVSYNELEGPLPNNKAFQQALPEALKGNKGLCGSVEGLQPCTHGSRNNRNRVF
GITFFLIAAIILLSAFFTIKFIVERKKKHPNKAEKNLHEEISFSVLNFDGKSMYEEIIRA
TENFDSTNCIGSGGQGSVYIANLSSNNIVAVKKLHQLWDGEKNFEKTFLNEIRALTEIRH
RNIVKLYGFCSHHRHSFLVYEFVERGSLIAILSKDEEAKEMGWRKRVNIVNGVAHALAYM
HHDCVPPIVHQDISSKNILLDSEYKAFVSDFGTAKFLNPDSTTWTAIAGTYGYVAPELAY
TMEVNEKCDVYSFGVVAMETIMGRHPGDFFSSFLSVSSSSMSSLALTLPPHQMSVVDVLD
QRILPPTHQEAGELLSLVKIAFSCLNPSPHSRPTMKKVSQLLSTSKLHLSKPMRMITCGE
LLTLDPLTA
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgctatatggtgaaatctcacaaaaatggggacaatgctcacaattaaaaaccttaata
attgcgggaaacaaccttactggtagcatacctcccgagattgtcaatgcagataaaatt
catgaacttgacctttcttcaaatcacttagttgggacgattccgaagggattcgggaga
atgacttctttgcaaaagttgatgttgaatggaaatcaactttcaagctctataccttcg
gaatttggattacttgttgatctagaatatctcgacttgtcgtcgaacagattcaatggg
tcaattgtgaccactttaggtgattttcccaaaatgtaccatctgaatttgagcaacaat
catttttcccaaggaattccatttaaattggaaaagttagttcagttgaacgaacttgat
ttaagtcacaactcacttgaaggtagcataccaccagcaatcagcaatatggagagtttg
caaacactcaatctttctcacaacaatctttcgggtttcataccatcaagtattgaaggc
atgcacggcttgttgtatgtggatgtatcttacaatgaattggaaggtccccttcccaac
aacaaagcatttcaacaagctctgcccgaagctttaaaagggaacaaaggactgtgcggc
agcgttgaaggtttacaaccttgcacacatggctcgagaaataaccgcaaccgggtattt
ggaatcacattcttccttatagcagcaattatacttctttctgctttttttacaattaaa
ttcatagtggaaagaaaaaagaaacatccaaataaagcagaaaaaaacttgcatgaagaa
atatcattttcagttttaaattttgatggaaagtcaatgtatgaggaaatcataagggca
acagaaaattttgattccacaaattgcatcgggagcggaggacaaggaagcgtctatata
gcaaatttgtctagtaacaacatagttgctgtgaagaaactacatcaattgtgggatggt
gagaagaattttgaaaagacattcttgaatgaaataagggcactaacagagataagacac
cggaatattgtgaagctttatggtttctgttcacaccatcgacactcatttttggtgtat
gagtttgttgaaagaggtagcttgattgcaattttgagcaaagatgaagaagctaaagaa
atggggtggagaaaaagggtgaatattgttaacggtgtagctcatgccttggcatacatg
caccatgattgcgtgccaccaattgtgcaccaagacatatcaagcaagaacattttgttg
gattctgaatataaggcctttgtttcagactttggcactgctaagtttttgaatccagac
tcaacgacttggactgccattgcaggcacatatgggtatgtcgcaccagaacttgcatat
accatggaagtgaacgaaaaatgcgatgtttatagctttggagtggttgctatggaaaca
atcatgggaaggcatcctggtgattttttctcatcattcttatcagtgtcttcttcgtcc
atgtcgtcattagcattaacattaccaccccatcaaatgtcagttgtggatgttctagac
caacgcattttgcctccaacacatcaagaagcaggggaattactctctcttgtgaagatt
gcattttcatgcttgaatccgagtccgcattctcgccctacaatgaaaaaagtttctcaa
ctcctctcaacttcgaagctccatttgtcaaagccaatgcgtatgataacctgcggtgaa
ttgcttactctagatcctttgacggcctga

DBGET integrated database retrieval system