KEGG   Malus domestica (apple): 114819288Help
Entry
114819288         CDS       T03194                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
mdm  Malus domestica (apple)
Pathway
mdm03040  Spliceosome
mdm04141  Protein processing in endoplasmic reticulum
mdm04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114819288
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114819288
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114819288
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdm01009]
    114819288
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mdm03041]
    114819288
   03009 Ribosome biogenesis [BR:mdm03009]
    114819288
   03110 Chaperones and folding catalysts [BR:mdm03110]
    114819288
   04131 Membrane trafficking [BR:mdm04131]
    114819288
   03051 Proteasome [BR:mdm03051]
    114819288
   03029 Mitochondrial biogenesis [BR:mdm03029]
    114819288
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdm04147]
    114819288
Protein phosphatases and associated proteins [BR:mdm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     114819288
Spliceosome [BR:mdm03041]
 Complex B
  Other components
   Prp19 complex
    114819288
 Complex C
   Prp19-CDC5 complex
    114819288
Ribosome biogenesis [BR:mdm03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    114819288
Chaperones and folding catalysts [BR:mdm03110]
 Heat shock proteins
  HSP70 / DNAK
   114819288
Membrane trafficking [BR:mdm04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    114819288
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    114819288
Proteasome [BR:mdm03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    114819288
Mitochondrial biogenesis [BR:mdm03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    114819288
Exosome [BR:mdm04147]
 Exosomal proteins
  Proteins found in most exosomes
   114819288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl PilM_2
Motif
Other DBs
NCBI-GeneID: 114819288
NCBI-ProteinID: XP_028957101
Position
1
AA seq 529 aa AA seqDB search
MAGEEGHAIGIDLGTTYSCVAVWEHDRVEIIVNDQGNRTTPSCVAFTETERLVGDSAINQ
IIRNPTNSIFDAKRLIGRRFNDATVQSDLKLWPFRVTEGPGGKPLIVVTHEGQEKQFAAE
EISAMVLVKMREIAEAYLNSTVKNAVITVPAYFNDSQRQATKNAGNTAGLNVMRIINEPT
AAAIAYGIDKKAGWYSKRNVMIFDLGGGTLDVSLLTIGDGVFEVKATAGDTHLGGEDFDN
KMVDFCVEQFKKNHNLDVSGNSKALRRLRNACEKAKRRLSFTSATDIEIDCLYEGTDFYT
TITRAKFEQLNMDFFNKCMEPVEKCLKDANMEVSSVHDVVLAGGSSRIPKVQELLQDVFK
GKQLCKSINPDEAIAYGAAVQAAVLSGNGTEKLQDFTLLDVTPLSLGIESQERGSSKLFM
NIVIPRNSRIPVMKKKFVTTVSDNQVSVDFPVYEGESSIAKNNNFLAEFTLDGIPPAPQG
VPLFEVCFNIDANGILNVSAEDQSTGQKKGITIKSDSDIRNFEGIEKVN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagaagaaggccacgcaatcgggattgatctggggacaacgtactcttgtgtc
gcagtgtgggagcacgaccgtgtggaaatcatagtgaacgatcagggtaacaggaccact
ccatcttgtgttgccttcactgagactgagcgattggttggtgattcggccatcaatcaa
atcatcaggaaccccaccaactccatttttgatgcgaagaggttaattggtaggagattc
aatgacgccactgttcaaagtgatttgaagctctggccatttagagtcactgagggtcct
ggcggcaagcccttgattgtggtcacccacgagggacaagaaaaacagtttgctgccgaa
gaaatttcagccatggttctagtgaaaatgcgggagattgctgaggcctacctcaactcc
actgtgaagaatgcagttatcactgtccctgcttacttcaatgattcacagcgtcaggct
acaaaaaatgctggcaacactgctggcctaaatgtgatgcgtatcatcaacgaaccaact
gctgcagcaattgcttatggcattgacaagaaggctggctggtatagcaagagaaatgtg
atgatatttgatttaggtggtggtactttagatgtttcactacttaccataggtgatggt
gtgtttgaagtgaaggccacggctggagacactcaccttggaggagaagacttcgataac
aaaatggtggacttttgtgttgagcaattcaagaagaatcataatttggacgtgagtgga
aactctaaagcactaaggaggttaagaaacgcatgtgagaaagcaaagaggaggctttcg
tttacttcagccactgacattgaaatcgactgtttgtatgagggaactgatttctataca
actattacccgtgccaaatttgagcaattgaatatggatttctttaacaagtgtatggag
ccagtcgagaagtgtttgaaggatgccaatatggaagtaagcagtgtccatgatgttgtt
cttgccggcggatcttctagaattcccaaagtgcaggaactgttgcaggatgtgttcaag
gggaagcagttgtgcaagagtatcaatccggatgaggcaattgcgtatggtgccgctgtt
caagctgcagtcttgagtgggaatggaactgagaagcttcaagacttcactctcttggat
gtcacccctttatcacttggaattgagagtcaagaacgtggtagttccaagttattcatg
aacattgtgattccaagaaattctagaattccagtcatgaagaaaaaatttgtaactacc
gtttctgacaatcaagtttcggtggactttcctgtttatgagggtgaaagcagcatagct
aaaaacaataactttttggctgaatttaccctcgatggtattcccccagctccgcaaggt
gttcctttatttgaagtttgtttcaatattgatgccaatggtatcctgaatgtctctgcc
gaagaccagtccaccggccaaaagaaagggattacaatcaagagtgacagtgacattagg
aattttgaaggaattgagaaggtgaactaa

DBGET integrated database retrieval system