KEGG   Malus domestica (apple): 114822069Help
Entry
114822069         CDS       T03194                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL15
Organism
mdm  Malus domestica (apple)
Brite
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114822069
Protein kinases [BR:mdm01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114822069
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Orthopox_35kD
Motif
Other DBs
NCBI-GeneID: 114822069
NCBI-ProteinID: XP_028951899
Position
16
AA seq 360 aa AA seqDB search
MCINEDLAESFGSDLYDFQLSELRAVTQKFSVNFLLGEGGFGTVHKGYIDENLRQGLKAQ
AVAIKLLDIEGLQGHREWLAEVIFLGQLRHHNLVKLIGYCCKNEERLLVYEFMPRGSLEN
HLFKRLSISLPWATRLKIAIGAAEGLAFLHGAETPVIYRDFKSSNVLLDSDFTAKLSDFG
LAKMGPEGSETHVTTRVMGTYGYAAPEYVSTGQLTIKCDIYSFGVVLLELLTGKRAMDKS
RPKSEQNLIEWAKPYMYSSRRLCCIMDPRLAGQYSVKGAKEIAHLALQCISMNPKDRPRM
PSIIETLESLRDLKDIAVAYGHWPASPKFARNGVFAKARMDGHRVGNIRKSSPTATANHK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtgtatcaacgaggatcttgcagagtctttcgggtcggatttgtatgattttcaactg
agtgagctgcgtgctgtgactcagaaattttcggtcaattttttacttggagaaggcggg
tttggaactgttcataagggttacattgatgagaatctgaggcagggtttgaaagctcag
gccgttgccattaagctcctcgacattgaaggcctacaaggacaccgcgaatggctagca
gaagtgatatttcttgggcagctcaggcaccataatttggtgaaattaattggctactgt
tgcaagaacgaggaaagactccttgtttacgagtttatgcctcgaggcagcttagagaat
cacttattcaaaaggctttcaatatcattgccttgggccacaagattaaagattgcaata
ggagcagccgaaggccttgctttcttgcatggggccgagacacctgtcatataccgggat
ttcaaaagttcaaatgttttgctagattctgatttcacagcaaagctgtcagattttgga
ctagcaaagatgggacccgaaggatcagaaacacatgtcacaacaagagtaatgggtacc
tatggatatgcagcccctgaatatgtctcaacagggcaattgacaataaaatgtgacatc
tacagctttggagtggtgctgctagaattgctaacaggaaaaagagcaatggataaatca
agaccaaagagcgagcaaaatctgattgaatgggcaaaaccttacatgtatagtagtcgg
aggttgtgctgtattatggacccgagacttgccggccagtattctgttaagggagcaaag
gagattgcccatctggcattacaatgcataagcatgaaccccaaagacaggcctagaatg
ccttccattatcgagactcttgaaagccttcgagacttgaaggacattgccgtcgcttat
gggcattggccggcatcaccaaaatttgctagaaatggtgtttttgctaaagctagaatg
gatggtcatagagttgggaatatcaggaaatcgtctccaacggcaactgcaaatcataaa
taa

DBGET integrated database retrieval system