KEGG   Malus domestica (apple): 114823384Help
Entry
114823384         CDS       T03194                                 

Definition
(RefSeq) beta-glucosidase 12-like
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00460  Cyanoamino acid metabolism
mdm00500  Starch and sucrose metabolism
mdm00940  Phenylpropanoid biosynthesis
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    114823384
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    114823384
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    114823384
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     114823384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 114823384
NCBI-ProteinID: XP_028954721
Position
Unknown
AA seq 311 aa AA seqDB search
MGYAVGTQVPGRCSSWQNLNCTGGDSAIEPYLVAHHLLLAHGAAVELYKNRYQATQKGLI
GITLVSDWFEPASDSKQDKDAALRSLDFMFGWFLDPLTSGDYPHTMRSIVGKRLPKFTKE
QSKLLNGSFDFLGINYYTARYASSAPNNNSLPASYVTDSRADLTTELNGALIGPQAASDW
LYVYPKGIHDLVLYTKEKYNDPLIYITENGVSELNNPELSLEEALHDTSRIDYYYRHLCY
LQAAIKNGAKVKGYFAWTLLDDFEWTAGYTVRFGLNYVDYKDGLKRYPKLSAHWFKNFLK
KNKFKESYSSL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgctgttggtactcaagtaccgggacgctgctcttcttggcaaaacctaaac
tgcaccggtggagattcagccattgaaccatacttggtggcacaccaccttcttcttgct
catggagcagctgtagaattgtacaagaatagatatcaggcaactcaaaaaggcctgata
gggataacattggtgtcagactggtttgagcctgcttcggattcaaagcaagataaagat
gctgccttacgatctttggattttatgtttggatggtttttggacccattaacaagtggt
gactatccacacaccatgcgatcaattgttgggaaaagattgcccaaattcacaaaagaa
caatccaagttgctaaacggatcatttgattttcttggaataaattattatactgctaga
tacgcaagtagtgcacccaacaacaattcactaccggcaagctacgtaacagattctcga
gctgatcttacaactgagcttaatggagcactcattggtccacaggctgcttcagattgg
ttatatgtatatccaaaaggaattcacgatcttgtgctttacacaaaggaaaaatataat
gatccactaatttatattactgagaatggtgtatcagagttgaataatccagaactatca
cttgaagaggcccttcatgataccagtagaattgactactactatcgtcacctgtgttac
cttcaagcggcgatcaaaaatggcgcgaaagtgaagggatactttgcatggacattgtta
gacgactttgaatggactgccggatacactgtccgatttggtttaaactacgtggattat
aaagatggcctgaaaagatacccaaaactctcagcacactggttcaaaaattttcttaag
aagaataaattcaaagaaagctacagttcattataa

DBGET integrated database retrieval system