KEGG   Malus domestica (apple): 114824474Help
Entry
114824474         CDS       T03194                                 

Definition
(RefSeq) receptor-like protein kinase FERONIA
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
mdm  Malus domestica (apple)
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdm01001]
    114824474
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     114824474
Protein kinases [BR:mdm01001]
 Serine/threonine kinases: TKL group
  IRAK family
   114824474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 114824474
NCBI-ProteinID: XP_028957446
Position
4
AA seq 435 aa AA seqDB search
MGFSSSTARSVMSRFFNNLWKKCAPYSSDHRRKPTDTDRDEAKWAFPEELCRRFSLAEII
AATQNFNARLSLSSEVNGLIEEFLVFNPIEVPKTEDGINVSARGVYKGYTNLNGVTSTVA
IKRIPSTKGREFKAEVQLLCQLRHPNVISLIGFCQDKVGYAIVYDYMSNGSLSDSLFNPY
NDKNPLSWKQRLNICIGVARAIHYLHAGVKHAVIHRDVKCDNILLDQNLEAKLSNFRLSK
MGPPSLSNALIRLNSASEVSGTVGYLDPEYLLSRQLTEKSDVFSFGVVLFEVLSASFGAM
PRIYMVCPDDILDPFLMGKIAPDCLLKFLDIIQRCVRPTGAQRPTMGEVEVELELALELQ
ERADAEKELRTTSTPLDQPADCAYGYEGISVSELNETFSSLYMSRQSPVVSPTRSADFSV
LSDDDGSSEFEFSGR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggatttagtagtagtactgcacggtcagttatgtcacgtttcttcaataatttgtgg
aagaaatgcgcaccatattcatctgatcatagaagaaaacctactgatacagatcgagat
gaagctaaatgggcgtttccagaagaattgtgtcgtcggttttcactcgcggagatcata
gcagcaactcaaaacttcaatgctaggttaagcttgtcatctgaagttaatggcctaata
gaagagtttttggtgtttaatcccattgaagttccgaaaacagaagacggtattaatgtt
agtgctcgaggggtctacaaaggatacaccaacctcaacggggtaacttccactgtagca
atcaagcgcattcccagcacaaagggacgtgagttcaaggcagaggtgcagctactgtgc
cagttgcgccaccccaatgtcatctccctaatcggattctgccaagacaaggtagggtat
gccattgtttacgactacatgtccaatggttccctctctgattctcttttcaatccttat
aacgataagaatcccttgtcttggaagcaaaggctgaatatctgcattggagtggcgcgc
gcaatacactaccttcacgcaggggttaaacatgctgtcatccaccgagacgtcaaatgc
gacaacatacttttggaccaaaacttagaggccaagctttctaacttccggctgtcgaag
atgggccctccttctttgtcaaatgccttaatcagattgaactctgcttccgaggtgtca
ggtacagtcggatatcttgatccagagtatcttctgtctcgccagcttacggaaaaatct
gatgtcttctcgtttggagtggtgttattcgaagttttgtctgccagttttggagcgatg
ccacgaatatatatggtttgcccagatgatattctagacccatttctcatgggaaaaata
gctcccgattgtttgttaaaatttttggacatcatccaaagatgcgtccgccctacagga
gcccaacggcccacgatgggtgaagtggaggtggaacttgagcttgcactggagctgcag
gagagagcagatgccgaaaaggagttgaggacaactagcactcctcttgatcagcctgcc
gactgtgcctacggttatgaagggatatcagtttccgaattgaatgagactttctcgtcc
ctatacatgagtagacagagtccagtagttagcccaaccaggtctgctgatttttcagta
ctttctgatgacgacggtagctctgaattcgaattttctggccggtaa

DBGET integrated database retrieval system