KEGG   Malus domestica (apple): 114825822Help
Entry
114825822         CDS       T03194                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
Organism
mdm  Malus domestica (apple)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kinase-like UPF0223 PIP49_C
Motif
Other DBs
NCBI-GeneID: 114825822
NCBI-ProteinID: XP_028960667
Position
7
AA seq 389 aa AA seqDB search
MLFQNIICRIDTYLSGFLVGATLGSFTFLLLVVAVSQVHSYDTKEKENQIKIRRFLQDYK
AHKASRYSYADIKRITNQFQDKLGQGAYGTVFKGKLSSECFVAVKVLNSSNGNGEDFVNE
VGTMGHIHHVNVVRLVGFCADGFNRALVYEFFANGSLHDFISSADNNNRLLGWDKLQDIA
LAVAKGVQHLHQGCDQRILHFDIKPHNVLLDDNFTQKISDFGLAKLCSKDQSIVSMTTAR
GTMGYIAPEVFSRNFGNVSYKSDVYSFGMLLLEMVGGRKNIDSTSENTNEIYYPEWIYNL
LEEGDDLRIHLGEKGDGKAPKKLAIVGLWCIQWHPAGRPSMNEVVQMLEGGENLTMPPNP
FASTGPARANATAPAKNLNIQLEAIAELE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctttttcaaaatatcatttgcaggatagatacttatctttcgggatttctagtaggt
gcaaccttgggttcattcaccttcttgctactagtcgttgcagtctctcaggtccatagc
tatgatacaaaggaaaaagaaaatcaaattaagattagaagatttttacaagattacaaa
gctcacaaagcaagcaggtattcctacgcagatattaagaggatcacaaaccaattccag
gacaagttaggccaaggagcctatggaactgtttttaaaggaaagctttcttctgaatgc
tttgttgctgtaaaagttctcaatagttccaatggaaatggggaagatttcgtaaatgaa
gttggaacgatgggacatatccaccatgtcaatgtggttcgcttggttggtttctgtgct
gatggatttaacagagctcttgtttatgagttctttgccaatggttcactgcatgatttc
atttcatcggcagacaataacaatcgccttctcggttgggacaagttgcaagatattgct
ctagctgtagccaagggagttcaacatcttcatcagggatgtgatcaacgaatcctccat
ttcgacatcaaacctcataatgtattgttagacgataatttcactcaaaaaatttcggat
tttggtttggccaagttgtgttctaaggatcaaagcatagtgtccatgactacagctaga
gggacaatgggatacattgcacctgaagtgttctccaggaactttggaaatgtgtcctat
aagtcggacgtctatagttttgggatgctgctccttgagatggtagggggaaggaagaac
attgattcaacctccgaaaacacaaatgaaatttactatccagaatggatctataatctt
ctagaagaaggagacgacctacgaatccatctgggagagaaaggagatggtaaagctcca
aagaaacttgcaattgtagggctctggtgcatccagtggcacccagcgggtcgtccttcc
atgaacgaggttgttcagatgttggaaggaggagaaaacttaaccatgccccccaatcct
tttgcttctaccggtcctgcacgagcaaatgcaactgcgcctgcgaaaaatctaaacatt
cagttagaagctattgctgaattagagtaa

DBGET integrated database retrieval system