KEGG   Methylomonas denitrificans: JT25_011355Help
Entry
JT25_011355       CDS       T04191                                 

Definition
(GenBank) hypothetical protein
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
mdn  Methylomonas denitrificans
Pathway
mdn00030  Pentose phosphate pathway
mdn01100  Metabolic pathways
mdn01120  Microbial metabolism in diverse environments
mdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JT25_011355
Enzymes [BR:mdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     JT25_011355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF4921
Motif
Other DBs
NCBI-ProteinID: AMK77075
UniProt: A0A126T4Q3
Position
complement(2476411..2477136)
Genome map
AA seq 241 aa AA seqDB search
MNTATAAQPLQGRTALVVQANAGIGAAVAEAFAAAGARVMINYLHENAGADQVAQRIRIK
QGQTMIFQADISQESQVKSMFDVLVAYWGGLDILVTNAHLEIDNSALDINRKPSQTVLTQ
NLVGHFLCVRQAMHEFSRQGCQSALPNSAGNIICVSSLRNGLSQEGQINYTVCKPSMSSL
LQDFAAALGQANTNIDLASADVPSLAEYWGTNQEDIANAAVGLAAAAYADPISNNLKIGG
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgcaactgccgcgcagccgctgcaaggccgaacagccttggtcgttcaagcc
aatgccggcatcggtgccgcagtcgcggaagcattcgctgcggccggcgccagggtgatg
attaactatctgcatgaaaatgcgggagccgaccaggttgcgcaacgtattcgcatcaaa
caaggacaaaccatgatatttcaggccgatatcagccaggaaagtcaggtgaaaagcatg
tttgatgtcttggtcgcttattggggcggcctggatatattggtcactaatgcccatctg
gaaatcgacaactcggcgctggatataaatcggaagccatcgcagaccgtccttactcaa
aatctggtcgggcactttctgtgcgttcggcaggccatgcatgaattttccagacaaggc
tgccagtctgcattgccgaattcggcaggcaacatcatttgcgtgtcctctttgcggaat
ggtttaagtcaagaggggcagatcaattacacagtctgcaaacccagcatgagcagtttg
ctccaggacttcgctgcagcgcttggtcaagccaataccaatattgatctcgcttctgcg
gacgttccctcccttgctgaatattggggcaccaatcaagaggatattgcaaatgcggct
gtcggcttggctgcggctgcttatgccgatccaatttcgaataaccttaagatcggagga
tcatag

DBGET integrated database retrieval system