KEGG   Methylomonas denitrificans: JT25_014750Help
Entry
JT25_014750       CDS       T04191                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mdn  Methylomonas denitrificans
Pathway
mdn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mdn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    JT25_014750
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mdn03011]
    JT25_014750
Ribosome [BR:mdn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    JT25_014750
  Bacteria
    JT25_014750
  Archaea
    JT25_014750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AMK77717
UniProt: A0A126T6J8
Position
3195707..3196039
Genome map
AA seq 110 aa AA seqDB search
MEVSAKLSNAPLSAQKARLVGDQIRGLPVEKALNLLSFSSKKAAAIIKKVLESAIANAEH
NESADVDELKVSTVFVNEGRTLKRVSARAKGRANHILKRTCHITIKVAEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtttcggctaaattaagtaatgctcctctctctgcgcaaaaagcacggcttgta
ggggatcaaatacgcgggttacctgttgaaaaagcattgaatttgctgagtttcagctct
aagaaagctgctgcgataatcaaaaaagttctagagtcggcaatagctaatgcggaacat
aacgaaagtgctgatgttgatgagttgaaggtttcgaccgtattcgttaatgaaggcagg
acgttaaagagagttagcgcaagggcaaaaggacgtgcgaaccacatcctgaaaagaact
tgtcatataacaattaaagtagcagagaaatag

DBGET integrated database retrieval system