KEGG   Methylomonas denitrificans: JT25_018135Help
Entry
JT25_018135       CDS       T04191                                 

Gene name
cpsB
Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
mdn  Methylomonas denitrificans
Pathway
mdn00051  Fructose and mannose metabolism
mdn00520  Amino sugar and nucleotide sugar metabolism
mdn01100  Metabolic pathways
mdn01110  Biosynthesis of secondary metabolites
mdn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mdn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    JT25_018135 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    JT25_018135 (cpsB)
Enzymes [BR:mdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     JT25_018135 (cpsB)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     JT25_018135 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer NTP_transf_3 Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AMK78385
UniProt: A0A126T8G6
Position
3939770..3941173
Genome map
AA seq 467 aa AA seqDB search
MMIPVVLSGGSGTRLWPLSRGQYPKQFLPLVSGNTMLQETILRLDGVAGLQAPIAVCNED
HRFMLAEQMREIGIKPAAIILEPVGKNTAPAVAMAALSARSEDDVLLILPADHVVGNRSA
FHRAVAQAELLAKQDLLVTFGIVATEPETGYGYIKRGETRYGEAYKVAAFVEKPDLQTAQ
RYLESGEYFWNSGMFAFKAGCFLRELEKFNPEMLEVCREALRAAKPDLDFVRLDKQIFST
CPSDSIDYAVMEKTDKAVVIPLDAEWNDVGSWSALWDVTEKDAAGNAIKGDVLTVDTRNS
YIHSANKLVAVIGVENLVVVETDDAVMIAAKDRVQDVKEVVDQLKKLKRTEASVHRKVYR
PWGHYDLVDAGERHQTKRIVVKPGAKLSVQKHHHRAEHWVVVKGTAWVDKNGEKILVTEN
ESIYIPLGVIHSLENPGVIPLEMVEVQSGSYLGEDDIVRYEDQYGRI
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
attatgatcccggtagttttatcaggtggttcaggaactcggctatggccattgtctcgc
ggtcagtatcccaaacaatttttacctttggtgtccggcaacaccatgctccaagaaacc
attttacggcttgatggcgtcgccggtttacaagcgccgattgcggtttgtaatgaagac
catcggtttatgctcgcggagcaaatgcgggaaatagggatcaaaccggccgctattatc
ctggagccggtcggcaaaaataccgcgccggccgtagcgatggccgcattgagcgcacgc
tccgaagacgatgtgttgctgattttgccggccgatcatgtggtcggcaatcggtctgct
tttcatcgggcggtggcccaagccgaactattggcgaaacaggatctactggtgacgttc
ggaatcgtcgcgaccgaaccggagaccggctacggttacatcaagcgcggcgaaacccgt
tacggcgaagcatataaggttgccgcctttgttgaaaagcctgatttgcaaaccgcgcaa
cgttatttggaaagtggcgaatatttctggaacagcggcatgtttgcctttaaagccggt
tgtttcctgcgtgagttggaaaaattcaacccggaaatgctggaagtttgtagggaagcc
ttgcgggcggcaaaaccggacctggactttgtccgtttggataagcagattttttcgact
tgcccatccgactccatcgattatgcagtgatggagaaaaccgataaggcggtggtgatc
ccgttggatgcggaatggaacgatgtcggctcctggtccgcactttgggatgtaactgaa
aaagatgctgccggcaatgccatcaaaggcgatgtattaacagtggatactcgcaattcc
tatattcactccgctaacaaactggtagcggtgataggcgtggaaaatttggtagtggtg
gaaacagacgatgcggtaatgatcgccgctaaagatagggtgcaagacgtcaaggaagtg
gttgatcagctgaaaaaattgaaacgtaccgaggccagtgtgcatcgtaaagtctacagg
ccatggggacattacgatttggtcgatgccggcgagcgccatcaaaccaagcgtatcgtc
gtgaaacccggtgcgaaattatcggtacaaaagcatcatcaccgtgccgagcactgggtt
gtggtcaaaggcacagcttgggtcgacaaaaatggcgagaaaattttggttaccgaaaac
gaatcgatttacatcccgttgggcgttattcatagtctggagaatccgggggtgattccg
ctggagatggtggaagttcaatcgggcagttatctcggcgaagacgacattgttcgttac
gaagatcaatacggccgaatttaa

DBGET integrated database retrieval system