KEGG   Methylomonas denitrificans: JT25_020925Help
Entry
JT25_020925       CDS       T04191                                 

Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
mdn  Methylomonas denitrificans
Pathway
mdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    JT25_020925
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    JT25_020925
Enzymes [BR:mdn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     JT25_020925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: AMK78917
UniProt: A0A140E693
Position
4542895..4544268
Genome map
AA seq 457 aa AA seqDB search
MSEQTNAYQAISTPGREVWLTTADQRVLFQPQTSPFSFNDNLDDLPAITVDAGDIYQTME
GFGFSLTGGSAMLIAALPDLERQALLRELFLPDGDGIGVSFLRLSIGASDLSERCFSYDD
MPDGQTDPELAYFDLNAGDSDVIPLLLEILTLNPNIKIIATAWSAPRWMKTNQAFVGGKL
KPEYHGVYAAYLVKYLQAMRERGIVIHAITPQNEPLNQKNEPSMIMEASEQAEFIKDHLG
PALRDAGLTDVELFCWDHNCDVKEYPLTVFADADARQYLSGSAWHLYGGDISVLSEVHQA
YPDMKLYFTEQWVGSDGEFGGDLMWHVRHVLIGSMQHWSRAVLEWNLASDPFCGPHTPGG
EARCVGALTVDGNEVVRNVAYYVIAHAAKFVRPGSVRINSGEQSDLPNVAFLTPTGSIVL
IALNDTAEPQEFAIQYLGKSAVATLPARAVATYVWAA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcaaaccaatgcttaccaagcaatatccactccaggccgggaggtttggttg
actaccgccgatcagcgtgttttgtttcaaccgcagacaagtccatttagttttaacgac
aacctagacgatttgccggcaataacagtcgatgccggcgatatttatcaaaccatggag
ggcttcggattctccttaaccgggggaagcgccatgctgattgctgcgctacccgatctc
gaacggcaggctttattacgggaattgtttttgcctgatggcgacggtatcggcgtcagt
tttttgcgccttagcatcggtgcctcggatttaagcgaacgttgttttagctatgacgat
atgccggatggacaaaccgaccccgagcttgcatattttgatttgaacgccggggatagt
gacgttatcccgctgctcctggagattctgactctcaatccaaatatcaaaatcatcgct
accgcctggtcggcgccgcgctggatgaagaccaaccaggcttttgtcggcggtaaactc
aagccggaataccatggtgtctacgccgcgtatttagtgaaatatctgcaagccatgcgc
gagcgcggcatcgtgatccatgccatcactccgcagaacgagccgctgaatcaaaaaaac
gaacccagcatgattatggaagccagtgagcaggccgaatttataaaggatcatcttggg
ccggccttgcgcgacgcgggtttaaccgatgtggagttgttttgctgggatcacaattgc
gatgtcaaagaatacccgttgacggtattcgccgatgccgacgccaggcagtatctcagc
ggctcggcctggcatctgtacggcggtgatatttcggtgttatcggaagtgcatcaggct
tacccggacatgaagctgtatttcaccgagcaatgggtaggttcggacggtgaattcggc
ggggatttaatgtggcacgtccgccatgtgttgatcggctccatgcagcattggagcagg
gcggtgttggaatggaatttggcctccgacccgttttgcggcccgcatacgccgggcggc
gaagcccgttgtgtgggggcgttgacagtggacggcaacgaagtagttcgtaatgtcgcc
tattacgtgattgcccacgcggcgaaattcgtccggccgggttctgtcaggattaattcg
ggcgagcaaagcgatctgccaaacgtggccttcctcacgccaactggctcgatcgtgttg
atcgcgctaaacgacacggccgaaccgcaagagtttgccattcaatatctaggcaaaagc
gcagtagccacgttgccggcaagggctgtggctacttatgtttgggcagcctag

DBGET integrated database retrieval system