KEGG   Monodelphis domestica (opossum): 100010159Help
Entry
100010159         CDS       T01031                                 

Gene name
DHX8
Definition
(RefSeq) DEAH-box helicase 8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100010159 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mdo03041]
    100010159 (DHX8)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100010159 (DHX8)
Spliceosome [BR:mdo03041]
 Complex C
  Other components
   Step II factors
    100010159 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 Flavi_DEAD AAA_30 PhoH AAA_16 Sigma54_activ_2 ABC_tran Transformer Spem1 Presenilin
Motif
Other DBs
NCBI-GeneID: 100010159
NCBI-ProteinID: XP_001363005
Ensembl: ENSMODG00000015181
UniProt: F7BWD9
Position
2
AA seq 1196 aa AA seqDB search
MAEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVINLAEKNTTFETFKASLTK
NGAEFTDSLISNLLRLIQTMRPPAKPSAVKDPVVKPKTEKEKLKELFPALCRPDNPTVRT
MLDEDDVKVAVDVLKELEALMPSAAAHEKQRNSEHCDRAKKKKRSRSRSRDRDHKRRHRS
RSRSRSRTRDRNKGKSRYRSRSRSQSPIKDRKDRDKYGEKNNDRWRDKHVDRPPPEEPSI
GEIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRVKVKVL
SFTGTKTSLSMKDVDQDTGEDLNPNRRRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDD
TLERKRLTRISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEIELVEE
EPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQSALAKERRELKQAQREAEMDSIPMG
LNKHWVDPLPDVDGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQLSIIEQRES
LPIFKLKEQLVQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAM
SVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLTQYAIIML
DEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATLDAVKFSQYFYEAPIFTIPGRTYPV
EILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKSLGPDV
PELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQKV
YNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTN
LASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRRMAEFP
LEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQTEGDHLT
LLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKATVRVQ
KAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTKEYMRE
VTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAWRISRAFRRR
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccgggacccgccgaagagctcgcaaagctcgagtacctgtccctggtttca
aaggtgtgcactgagctggacaaccacctggggatcaacgacaaggacctggctgaattt
gtgatcaatcttgctgagaaaaatacaaccttcgaaacttttaaagcttccctcaccaaa
aatggtgccgaattcacagactctcttataagcaacttgttacgtctcatacagaccatg
cggcccccagcaaagccttctgctgtcaaagatccagttgttaaaccaaagacagaaaaa
gaaaagctcaaggaactgttcccagcactttgccgaccagacaatcctacagtccggacc
atgcttgatgaagatgatgtcaaagtagccgtggatgtcctcaaagagctggaagctcta
atgcccagtgctgccgcacatgagaagcaaagaaactctgaacactgcgacagggcaaag
aagaagaaacggagtcggagtcgaagccgagacagagaccacaaacgaagacatcggtcc
cgatcaaggtcacgctctaggactcgggataggaataaagggaaatccagataccgatct
aggagcagaagtcaaagtcctatcaaagaccgtaaggaccgtgataaatatggggagaag
aacaatgacagatggcgagacaaacatgtggaccggccccctcctgaagagccttccatt
ggggaaatttacaatggcaaagttaccagtatcatgcagtttgggtgttttgtgcaactg
gaaggactaaggaaacggtgggaaggtttagttcacatttccgagcttcgccgggaaggc
cgagtggccaatgttgctgatgttgtgagcaaaggccagagggttaaggtgaaagtcctg
tcttttactgggactaaaaccagcctgagtatgaaggatgtggatcaggatactggagaa
gatctgaatccaaatcgacgcaggaaccttgttggggaaaccaatgaggaaacctctatg
aggaaccctgatagacccactcacctctcccttgttagtgccccagaagtagaagatgac
acacttgaacggaaacgcctcacccggatctcagatcctgagaaatgggagatcaaacag
atgattgcagccaatgtactttccaaagaagagtttccagattttgatgaagagacggga
atccttcctaaagtggatgatgaagaagatgaggacctggagattgaattggttgaggaa
gaacctccattcctgagaggacacaccaaacaaagcatggacatgagccccattaagatt
gttaagaatcctgatggctccttgtcccaagcagcaatgatgcagagtgctttggccaaa
gaaaggagagaactcaaacaggcccaacgtgaagcggagatggactctatccctatggga
ctcaacaaacactgggtggatcctctacctgatgtggatgggaggcagattgctgccaac
atgcggggcattgggatgatgcctaatgacatacctgagtggaagaagcatgcttttggg
ggcaacaaagcatcttatggtaaaaagacccagctgtcaatcattgagcagagggaaagt
ctccccattttcaaactcaaagagcagcttgttcaggctgttcatgacaatcagatcctg
attgttattggagagactggttcggggaagacaacacagatcacacagtaccttgctgag
gcaggttacacctccagggggaaaattggatgtacacaacctcgaagggtggcggcaatg
tcagtggccaaaagagtatctgaggagtttggttgttgcttaggccaagaggtgggctac
actattcgttttgaagactgcaccagcccagaaacagtcatcaaatacatgacagatggg
atgttgctcagggagtgtttgattgaccccgaccttactcagtatgcaatcatcatgttg
gacgaggctcatgagagaacaattcacacagatgttctctttggattgttgaaaaagaca
gtgcaaaaacggcaagacatgaagctaattgttacctcagccacattagatgctgtgaaa
ttttcccagtatttctatgaggctcccattttcaccattccaggccgaacatatccggtg
gaaattctctacactaaagaacctgagacagattacttggatgccagcctgattacagtc
atgcagatccatttaactgaaccaccaggtgatatcctggtatttctgactggtcaggaa
gaaattgatacagcttgtgagatcttgtatgaacgcatgaagtctctgggacctgatgtg
cctgaattaatcatcctccctgtgtattctgctctaccaagtgagatgcaaacccggatc
tttgacccagctcctcctggtagcaggaaggttgtaattgctaccaacatagctgagact
tctctgactattgatgggatctactacgtggtggaccctgggtttgtgaagcagaaagtg
tacaactccaagactgggatcgaccagctggtggtgactcccatctctcaggctcaggca
aagcagagggctggcagagctgggagaacagggcctggaaaatgttatagactctacaca
gaacgtgcctaccgagatgaaatgctgaccaccaatgtgcctgagatccagagaactaat
ttagccagcacggtgctttctctcaaggccatgggcatcaatgacctgctttcctttgac
ttcatggatgcccccccaatggagactctgatcacagccatggagcaactgtacacatta
ggagccctggatgatgagggcctgctcacccgtctgggccgaaggatggcagagtttccc
ctggagccaatgttgtgcaagatgctgatcatgtctgtgcatctaggctgcagtgaagag
atgctcaccattgtgtccatgctgtcagtgcagaatgtcttctacaggcccaaggataaa
caagcccttgcagatcagaagaaagccaaattccaccagactgaaggtgaccacctcact
cttttggctgtgtacaattcttggaagaacaacaaattttccaacccctggtgttatgag
aatttcatacaggctcgttccttgcgccgagcccaggatatccgtaaacagatgttgggc
atcatggatagacataagctggatgtggtgtcctgcggcaaggctacagtccgtgtacag
aaagccatctgcagtggtttcttccgaaatgctgccaagaaggacccacaagagggctat
cgaactttgattgaccagcaggtggtctatattcatccctccagtgctctcttcaacaga
cagccggaatgggtggtataccatgagctggtgttgactaccaaggagtacatgagggag
gtcaccaccattgacccccggtggctggtggagtttgccccagccttcttcaaggtatca
gaccccacaaagctcagcaagcagaagaagcagcagcggcttgagcccctgtacaaccgc
tatgaggagccaaatgcttggaggatctcccgggctttccggcggcggtga

DBGET integrated database retrieval system