KEGG   Monodelphis domestica (opossum): 100010465
Entry
100010465         CDS       T01031                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mdo01002]
    100010465 (ERAP1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100010465 (ERAP1)
Peptidases and inhibitors [BR:mdo01002]
 Metallo peptidases
  Family M1
   100010465 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N SesA
Other DBs
NCBI-GeneID: 100010465
NCBI-ProteinID: XP_001363584
Ensembl: ENSMODG00000020072
UniProt: F7GID7
Position
3
AA seq 963 aa
MIQRAQAPRNSGVCANFRNNNKMGFLSLKVPLMTASSLFISLLTILIVSPSLRCQNIKTD
SPMATNGAPFPWNKMRLPTYILPVHYNLMIHANLTTLTFLGATEVEIITSEPTSFIILHS
QYLQITKATLREKSQESLAEQPLTVLEYPPNEQIALLADKPLLTGHQYLVTIEFTAPLSE
TLHGFYKSSYRTQKGEVRILASTQFEPTAARMAFPCFDEPAFKANFSIKIRREPRHLAIS
NMPLVKSVNIAEGLIEDHFDVTVKMSTYLVAFIISDFESVSKMTKSGVKVSVYAVPEKIS
QTGYALDAAVTLLEFYEDYFGIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLYDTK
TSSASSKLWITMIIAHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPHLKVE
DYFFGKCFSAMEMDALNSSHPVSTPVENPAEIREMFDDVSYEKGACILNMLRDYLNADVF
KAGIVRYLKKYSYKNTKNVDLWNSMRNICPTGDTQKTDGFCSRKQSISSPSHWSQEVVDV
KAMMNTWTLQKGFPLITVSKKGKNVHVRQELYRKGTNHSEETGYLWHVPLSYITSKSDKV
ERFLLRTKADVLILPEEVEWIKFNMGMYGYYIVHYEGDGWESLTGLLKGKHMTISSNDRA
SLINNAFQLVSIGKLSIEKALDLTLYLKRETEIMPVFQGLNELIPLYKLMEKRDMDDVET
QFKAFLITLFKDLIDNQTWTDEGSVSQRMLRSQLLLLACVRQYQPCVQKAEEYFKKWKES
NGNFHLPNDVTSAVFAVGAQTTEGWDFLFEKYQFSLSSTEKNKIELALSISHNKEKLQWL
LNQSFQGDIIKTQEFPHILSSVGRNPKGYHLAWQFLKENWNRIIQKFELGSASIAFMVTG
TTNQYSTRERLEEVKEFFSSLNENGSQLRCVQQTLETIEENIRWMDQNYEKIKVWLQKSP
SSL
NT seq 2892 nt   +upstreamnt  +downstreamnt
atgatacagcgggctcaggcccctagaaattcaggggtttgtgccaattttaggaacaac
aacaaaatgggttttttatcccttaaggtgccacttatgactgcatcatctctttttatt
tccttattgaccatcttgattgtgtcaccttctttgaggtgccaaaacataaaaacggac
tctccaatggctactaatggagcaccatttccttggaataagatgcggcttcccacctac
atccttccagttcattataatcttatgatccatgccaatctcaccactttgacattcttg
ggagccactgaagtggaaatcatcaccagtgagcccaccagtttcatcattctgcatagc
cagtacctgcagatcaccaaggcgaccctccgagaaaagagccaagagagtctggcagag
cagcccctgacagtcctagagtatccacccaatgagcagatcgcccttctggcagataag
cctcttctgactggacatcagtacctagttaccattgaattcactgcccctctttctgag
acgctgcatggattttataaaagttcttatagaactcaaaagggagaagtaaggatacta
gcatccacacagtttgagccaactgcagctcgtatggcctttccctgctttgatgaacca
gcctttaaagccaatttctcaatcaagattagaagagaaccacggcaccttgctatctca
aacatgccattagtaaaatccgtgaatattgctgaaggactaatagaggaccacttcgat
gtcactgtgaagatgagcacttacctcgttgcttttattatttcggattttgagtctgtc
agcaagatgaccaaaagtggagtcaaggtttctgtgtatgctgtgccagagaagattagc
caaacaggctatgccctagatgctgcagtgacccttctggagttttatgaggattatttc
gggattccatatcctttacctaaacaagatcttgctgccatccctgactttcagtctggt
gccatggaaaactggggactgacaacgtacagagaatccgcactgttgtatgataccaaa
acatcctctgcttccagcaaactttggatcaccatgattatagctcatgaactggcccac
cagtggtttgggaatctggtcactatggaatggtggaatgatctttggctaaatgaagga
tttgcaaagtttatggagtttgtgtctgtcagtgtgacccatccacatttgaaagttgaa
gattatttctttggaaaatgtttcagtgccatggaaatggatgcattaaattcttctcat
cctgtgtccacacctgtggaaaatcctgctgagattcgggaaatgtttgatgatgtttct
tatgaaaagggagcttgtatcttgaatatgctaagggactatcttaatgcagatgtattc
aaagctggcattgtgcgatatctcaagaaatacagttataagaataccaaaaatgtggat
ctatggaatagtatgagaaatatttgtcccacaggtgatacccaaaagacagatggattt
tgctcaagaaagcaatcaatatcctcaccttctcactggagccaggaggtcgttgatgtg
aaggccatgatgaacacatggacactacaaaaagggtttccactgatcactgtctccaag
aagggaaagaatgtccacgtaagacaagaactctatagaaagggaaccaatcactctgaa
gaaactggatatttatggcatgttcctttgtcatacattaccagcaaatcagacaaagtt
gaaagatttttgctaagaacaaaagcagatgttctcatcctcccagaagaggtggaatgg
atcaaattcaatatgggaatgtatggttactatattgtacattatgagggcgatggatgg
gaatctttgactggcctcttaaaaggaaagcatatgacaatcagcagtaatgatcgagca
agcctcattaacaatgcatttcagcttgtcagcattggaaaattatctattgaaaaagct
ttggatttaactctgtacctgaaacgtgagactgaaattatgcctgtgttccaaggtttg
aatgagctgattcctttgtataaattaatggagaaaagagatatggatgatgtagaaact
caatttaaggctttcctcatcacgttgtttaaggacctcattgacaaccagacatggaca
gatgaaggctcagtctcacagcgaatgctgcgcagtcagctccttctcctcgcttgtgtg
cgccagtatcaaccttgtgttcagaaggcagaagaatatttcaagaaatggaaagaatcc
aatggaaattttcacttaccaaatgatgtgaccagtgccgtgtttgctgttggggcacag
accacagaaggctgggattttctctttgagaagtatcagttttctctatccagtactgag
aaaaacaaaattgaattggcactttctatcagccataataaagaaaaacttcaatggtta
ctgaatcagagttttcagggggatataataaaaactcaggagtttccacacattcttagt
tctgtgggcagaaatccaaagggttatcacttggcttggcaatttctgaaggaaaattgg
aatagaatcatacagaagtttgaacttggctcagcttctatagctttcatggtgactgga
acgacaaatcagtactctaccagagagcgactggaggaggtgaaagaattcttcagctct
ctgaatgaaaatggttcccagcttcgctgtgtccagcaaacacttgagacgattgaagaa
aacatacgctggatggatcaaaattatgaaaaaatcaaagtgtggttacaaaaaagcccc
agctcattgtaa

DBGET integrated database retrieval system