KEGG   Monodelphis domestica (opossum): 100011201Help
Entry
100011201         CDS       T01031                                 

Gene name
ETNPPL, AGXT2L1
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00564  Glycerophospholipid metabolism
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100011201 (ETNPPL)
Enzymes [BR:mdo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     100011201 (ETNPPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Limkain-b1
Motif
Other DBs
NCBI-GeneID: 100011201
NCBI-ProteinID: XP_007495879
Ensembl: ENSMODG00000020597
UniProt: F7A071
Position
5
AA seq 555 aa AA seqDB search
MPSLTYNRGHLGELKNNNNNSTTTKTKGELSLAQSAGTGKWPDLPAGASARTLRETTWSI
CRRPRTMTELYSKAETVLLRKKYIGPSCKVFFNKDPLKIVRARGQYMFDENGGQYLDCIN
NVAHVGHSHPEVIKAAVKQMELLNTNSRFLHDSIVEYAKRLSETLPEKLSVCYFANSGSE
ANDLALRLARQYRDHQDVITLDHAYHGHVSSLIEISPYKFRKGKDVKKEFVHVAPTPDIY
RGKYREDHPDPASAYADEVKKIIEEAHKGGRKIAAFIAESMQSCGGQVIPPAGYFQKVAE
YVHKAGGVLIVDEVQVGFGRIGEHFWSFQMYGEDFVPDIVTMGKPMGNGHPLSCVVTTQE
IAEAFSASGMEYFNTYGGNPVSCAIGLAVLDVIEKEDLRGNATRVGNYLIELLNKQKAKH
SLIGDIRGIGLFIGIDLVKDHQKRTPATAEAQHIIYKMKEQRILLSADGPHRNVLKLKPP
MCFTKEDAKFMVEQLDKILTVLEEATGTRTEKLNEAEVSSDSASASTSQTDENASRKRNG
LYAEKRAGPGKRIKT
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgctaacttataacagagggcacttaggagagttaaagaacaataataataat
agcacaacaacaaaaaccaaaggggaactgagtttggcgcaaagtgctggaactgggaag
tggccagatctccccgctggtgccagtgctaggaccttgagagagacaacttggtcaatt
tgcagacgtcccaggaccatgactgagctgtatagcaaagctgagaccgtcctgctcagg
aaaaagtacatcgggccatcctgtaaagttttcttcaacaaggaccccctcaagatagtg
cgggccagggggcaatacatgtttgatgaaaatgggggacagtacctggactgcatcaat
aacgtcgcacatgtggggcacagtcacccagaagtgatcaaggctgctgtaaaacagatg
gagctgctaaatacaaattctcgtttcctccacgacagcattgtggaatatgccaagcgc
ctttccgaaacgctgccagagaaactctctgtttgctattttgctaactctggatctgaa
gccaatgatcttgccttacgcctggcccgacagtacagggatcaccaagatgtgatcaca
cttgaccatgcttaccatggccatgtttcttccttgattgaaatcagtccatataaattt
cgaaagggaaaagatgtcaagaaagaatttgtgcatgtagcaccaactccagatatctac
cgaggaaaatatagggaggaccatccagacccagctagtgcttatgcagatgaggtgaag
aaaattattgaagaagcccacaaaggtgggaggaagattgctgcctttattgctgagtcc
atgcagagctgtggaggtcaagtcattccaccagcaggctacttccagaaagtggcagaa
tacgtccacaaagcagggggtgtacttatagttgatgaagttcaagttggttttggtcga
attggagaacatttttggagcttccaaatgtatggtgaagactttgtgccagatattgtc
accatgggtaaaccaatgggcaatggacatccactgtcttgtgttgtgacaactcaagaa
attgcagaagcctttagtgcttccggaatggagtattttaacacgtatggaggaaatccc
gtgtcctgtgctattggcttggccgtcctggatgtaattgaaaaggaagatctccgagga
aatgcgacacgggttggaaattacttaatcgagttactgaataagcaaaaagcaaaacac
tcattgataggagatatcaggggcatcggcctttttattggaattgacttagtgaaagac
caccagaagagaacccctgctaccgctgaagcacaacacatcatctataagatgaaagaa
cagaggatacttcttagtgctgatgggccccacaggaatgttctcaaattaaaaccgcca
atgtgcttcacaaaggaagatgctaaattcatggtggaacagctggataaaattctaaca
gttttagaagaggccaccggaaccaggactgaaaagcttaatgaggccgaagtcagctca
gacagcgccagcgccagcaccagccagacggatgaaaatgccagcagaaagagaaacggg
ctgtatgcagaaaaacgagccgggccaggcaaaagaatcaagacgtga

DBGET integrated database retrieval system