KEGG   Monodelphis domestica (opossum): 100011386Help
Entry
100011386         CDS       T01031                                 

Gene name
CCNH
Definition
(RefSeq) cyclin H
  KO
K06634  cyclin H
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo03022  Basal transcription factors
mdo03420  Nucleotide excision repair
mdo04110  Cell cycle
Module
mdo_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100011386 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    100011386 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100011386 (CCNH)
Transcription machinery [BR:mdo03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100011386 (CCNH)
DNA repair and recombination proteins [BR:mdo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100011386 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N
Motif
Other DBs
NCBI-GeneID: 100011386
NCBI-ProteinID: XP_001362961
Ensembl: ENSMODG00000020228
UniProt: F7D4L4
Position
3
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFSSEEQLGRLRADANRKFKCKVVANGKVLANDPVFLEPHEELIICKYY
EKRLLDFCSIFKPTMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSAQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPI
LENPEVLRKTADDFLNRIALTDAYLLYTPSQIALTTILSSASRAGINMESYLSESLMLKE
NRTCLSQLLDTMKCMKNLVKKYEPPRPEEVAALKQKLEKCHSAELAFNINAKKRKGYEDD
EYVSKKSKLEEEEWTDDDLIDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacaacagcagccagaagcggcactggacgttctccagtgaggagcagttgggg
cgcctccgggccgacgccaaccgcaagttcaagtgcaaagtggtggcgaacgggaaggtt
ttggcaaatgatccagtctttcttgagcctcatgaagaattgatcatctgcaaatattat
gaaaaaagactattagatttctgttccatatttaagcctacaatgccaagatctgtggtg
ggtacagcatgtatgtatttcaagcgtttttacctcaataactcagtgatggaatatcac
cctcggataataatgctcacttgtgcatttttggcatgtaaagtagatgaatttaatgtg
tccagtgcacaatttgttggaaatctaagagagagtcctcttggacaggaaaaggcactt
gaacaaattttggaatatgaactcttacttattcagcagcttaatttccaccttattgtg
cacaatccttaccggccatttgagggttttctcattgacttaaagactcgttatccaata
ctagaaaacccagaagttctaaggaaaacagccgatgactttctaaatagaattgctttg
acagatgcttaccttttatatacaccttcacagattgctctgactaccattttatccagt
gcttctagggctggaattaacatggaaagttatttatcagaaagtcttatgctgaaagag
aatcgaacctgtttgtcacagttattagatacaatgaaatgcatgaaaaacttagtaaag
aagtatgaaccaccaaggcctgaggaagttgctgccctcaaacagaaactagagaagtgt
cacagtgctgaacttgcatttaatataaatgcaaagaagaggaaaggttatgaagatgat
gagtatgtctcaaagaaatctaagctggaagaggaagaatggactgatgatgatcttata
gattctctgtaa

DBGET integrated database retrieval system