KEGG   Monodelphis domestica (opossum): 100011562Help
Entry
100011562         CDS       T01031                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 2
  KO
K03259  translation initiation factor 4E
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo03013  RNA transport
mdo04066  HIF-1 signaling pathway
mdo04150  mTOR signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04211  Longevity regulating pathway
mdo04910  Insulin signaling pathway
Module
mdo_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100011562 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100011562 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    100011562 (EIF4E2)
   04150 mTOR signaling pathway
    100011562 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100011562 (EIF4E2)
  Aging
   04211 Longevity regulating pathway - mammal
    100011562 (EIF4E2)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100011562 (EIF4E2)
Messenger RNA biogenesis [BR:mdo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100011562 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100011562 (EIF4E2)
Translation factors [BR:mdo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100011562 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 100011562
NCBI-ProteinID: XP_001363208
Ensembl: ENSMODG00000002680
UniProt: F7AZJ1
Position
2
AA seq 245 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENNAQKDSEKERNERDRSQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFHNLWKT
RLNVP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgccttgaaagacgatgacagcggggaccatgaccagaatgaa
gagaacaacgcacagaaagacagtgagaaggaaagaaatgagcgagaccgaagtcagagc
agcagcaagaggaaggctgttgtccctgggcccgcagaacacccactgcagtacaactac
actttctggtattcccggaggacacccggccggccgaccagctcgcagagctatgaacag
aatattaagcagattggcacattcgcctccgtggagcaattctggaggttttatagccac
atggtacgtcctggggacctgacaggccatagtgacttccatctcttcaaagagggaatc
aaacccatgtgggaggatgatgccaataaaaatggtggtaaatggattattcggctccgt
aagggtttagcttcccggtgctgggagaatctgatacttgccatgttgggggaacagttc
atggtgggcgaagagatctgtggggcagtcgtctctgtccgtttccaggaggacattatt
tcaatatggaacaagactgccagtgaccaagcaaccacagcccgtatccgggacacgcta
cgtcgagtgcttaacctacctcccaacaccataatggaatacaaaacacacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcataacctctggaagacg
cggttgaatgtgccatga

DBGET integrated database retrieval system