KEGG   Monodelphis domestica (opossum): 100011817Help
Entry
100011817         CDS       T01031                                 

Gene name
XPO5
Definition
(RefSeq) exportin 5
  KO
K14289  exportin-5
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo03013  RNA transport
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100011817 (XPO5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mdo03016]
    100011817 (XPO5)
   03036 Chromosome and associated proteins [BR:mdo03036]
    100011817 (XPO5)
Transfer RNA biogenesis [BR:mdo03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    100011817 (XPO5)
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     100011817 (XPO5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 100011817
NCBI-ProteinID: XP_001365932
Ensembl: ENSMODG00000018963
UniProt: F7G0D4
Position
2
AA seq 1209 aa AA seqDB search
MSTDEVNGLCEQLVRAVTVMMDPSSTQRYRLEALKFCEEFKEKCPICVPCGLKLAEKTQT
PIVRHFGLQILEHVVKFRWNNMSRLEKVFLKNNVMGLISSGTQNILEEESHIKDVLSRIV
VEMIKREWPQHWPDMLKELDTLSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQ
TLTQNMEKIFSFLLNTLQQNVNKYRRMKTDASQEPKAQANCRVGVAALNTLAGYIDWVTM
NHITAENCKLLEMLCLLLNEPELQVGAAECLLIAVSRKGRLEDRKPLMILFGDVAMHYIL
SAAQTADGGGLVEKHYVFLKRLCQVLCALGSQLCALLGNDYDVETPPNLGKYLESFLAFT
THPSQFLRSSTQITWGALFRHEILSRDPLLLGMIPKYLRASMTNLVKIGFPSKTDSASCE
YSQFDFDSDEDFNAFFNSFRAQQGEVIRMACRLDPKTGFQMAGEWLKYQLSTPVDTGPMN
SRTGEGLCSIFSPSFVQWDAMTFFSESVINQMFRTLDKEEIPVNDGIELLQIVLNFNTKD
PLILSCVLTNVSALFPFVSYRPEYLPQVLSKLFSSVTFEIIEESKAPRTRAVRNVRRHAC
SSIIKMCRDYPQLVLPNFDMLYNHVKQLLSNELLLTQMEKCALMEALVLISNQFKDYKRQ
KVFLEELMSPVANLWLSEEMQRVLSDADAFIAYVGADNKICEPGLEDANGLNRSRISFCV
YTILGVVKRARWPTDLEEAKAGGFVVGYTPSGNPIFRNPCTEHVLKLLDNLLALIRTHNT
LYTPEVLAKLGDNFSKALDMLEVEKNAILGLPQPLLELYDSPVYKTVLERMQGFFCTLYE
NCFHILGKAGSSMQQDFYTVEDLATQLLNSAFINLNSIPDYRLRPMLRVFVKPLVLFCPP
EHYEALVSPILGPLFTYLHMRLSQKWQVINQRSLLCGEEETADENPESQEMLEEQLVRLL
TREVMDLITVCCVSKKGAEHNSTTNTTTTTNSSTTADGEDEEMVCTEVAPSAMPELTDLG
KCLMKHEDVCTALLITAFTSLAWKDTLSCQRTTTQLCWPLLKQVLSGTLLSDAVTWFFTS
VLKGLQMHGQHDGCMAALVHLAFQIYEALRPRYLEVRAVMEQIPEIQKESLDQFDCKLLN
PTLQKINDKRRKDHFKRLIAGCIGKPLGEQFRKEVHIKNLPSLFKKTKPLLECDVLENED
GCLSTIFEP
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacggatgaagtgaacggcctgtgcgagcagctggtgagggcggtgacggtcatg
atggacccgagctctacccagcgttaccgcctcgaggccctcaagttttgtgaagagttc
aaagaaaagtgtcccatctgtgtcccatgtggcctgaagttggctgagaaaacacaaact
cctatcgttagacactttggccttcagattctggaacatgttgtcaagtttcggtggaac
aacatgtctcgccttgagaaggtgtttctaaagaacaatgtcatgggactgatatcaagc
gggactcagaatattttggaggaagagagccacataaaagatgttttatctagaattgtg
gtggaaatgatcaagcgggaatggccacagcattggcctgacatgttgaaagaattggat
accctctctaaacaaggggaaacacagacagaactagtgatgttcatccttctgcgactg
gcagaggatgtggtgacttttcaaacactacctccccagagaaggagggacatacagcaa
acactaacccagaacatggaaaagatcttcagctttctgcttaatacccttcaacagaat
gtgaacaaatatcggcgaatgaaaacagatgcttcccaggagccaaaggcccaggctaac
tgcagggttggggtagcagcactcaacaccctggcaggctacattgactgggtgaccatg
aaccacattacagctgaaaactgcaaactattggagatgctgtgcttgcttctgaatgaa
cctgaacttcaagtaggagcagctgaatgtctcctaattgcagtcagcaggaagggtagg
ttggaagaccggaagcccttaatgatcttgtttggagatgttgccatgcattatatactc
tctgctgctcagactgctgatggtggaggcctggtagaaaaacactatgttttcttgaag
agactttgtcaggtcttgtgtgctttaggcagccagctatgtgctttgctgggaaatgat
tatgatgttgaaacaccaccaaaccttggaaaatacttggagtcttttctggcttttaca
acccatccaagtcagtttctgcggtcatcaactcagatcacttggggagccctcttccgg
catgaaattctatcccgggatcctctgcttttaggaatgatccccaaatatctccgtgct
tctatgactaacttggtgaagattggctttccttctaaaacagatagcgctagctgtgaa
tattctcaatttgactttgacagtgacgaggacttcaatgccttcttcaactcattccga
gctcagcagggagaggtgataaggatggcctgtcgcctagatcccaagactggttttcag
atggctggggagtggttgaagtaccagctttcaacacctgtggatactggaccaatgaac
tctaggactggagaaggcctttgttcaatcttctctccctcttttgtacaatgggatgcc
atgaccttcttttcagaaagtgtgattaaccagatgtttcgaacattagataaagaagaa
attccagtgaatgatggcatagaactcttgcagattgtactgaactttaataccaaggat
cccctcatcttgtcctgtgtccttaccaatgtttcagcactctttccatttgtcagttac
agaccagaatacctgccccaggtcctttctaagctgttttcatctgtcacttttgaaatc
attgaggaaagtaaggctcccaggactcgtgctgtaaggaacgtgagaagacatgcttgt
tcttctatcatcaaaatgtgtcgcgactatcctcaacttgtgctgcccaactttgacatg
ctttataaccatgtaaagcagctgctctccaatgagctgctcctgacacagatggaaaaa
tgtgctcttatggaagccctggttctaattagcaatcagttcaaggactacaagcggcag
aaagttttcctggaggagttgatgtcaccagttgccaacctttggctttccgaagagatg
caaagagtgctatcagatgctgatgcttttattgcctatgtgggtgctgataacaaaatc
tgtgaaccaggcctggaagatgccaatggtctaaatcgttcacgaataagtttttgtgta
tacaccattctgggagttgtgaaaagggctcgatggcccacagacctagaagaggctaag
gctggaggatttgtggttggctatactccaagtggcaatccaatctttcgtaatccttgc
acagagcatgtcctgaaacttctcgacaatttgcttgctcttataagaacccacaatact
ttgtacacaccagaggtactggctaaactgggagataatttctcaaaggctttggatatg
ctcgaagtagaaaagaatgctatcttgggacttcctcagcctctcctagaactctatgac
tctcctgtctacaaaacagtgttggaacggatgcagggtttcttttgtaccctttatgag
aactgtttccatatcctagggaaagcaggctcttctatgcagcaagacttctacactgtt
gaagaccttgccactcagcttctcaactctgcctttatcaacctgaacagcattcctgac
taccgactccgaccaatgcttcgggtttttgtgaaacctctggtactattctgccctcca
gagcattacgaagcccttgtatctcccatccttggacccctcttcacctacttgcacatg
aggctttcccagaaatggcaagtcatcaaccagaggagtttactgtgtggtgaagaagag
actgcagatgaaaatccagagtctcaagagatgttagaagagcaactggtgaggctgctc
actcgtgaagtcatggacctgatcactgtttgctgtgtttcaaagaaaggcgctgaacac
aatagtactaccaataccaccaccaccaccaatagcagcaccacagctgatggagaggat
gaagagatggtatgcacagaggtggccccctcagccatgcctgaactcacagatctgggc
aagtgtttaatgaagcatgaggatgtgtgtacagcactgctcatcacagcctttacttcc
ttagcttggaaggacaccttgtcttgccagagaaccaccacccaactctgttggcctctg
cttaaacaagtactctcgggaacactcctctctgatgcagtaacatggtttttcaccagt
gtgctgaaaggtttgcagatgcatgggcagcatgatggctgtatggctgcacttgtccac
ttggccttccagatatatgaggcattgcgccccagatacctggaggtgagagcagtgatg
gaacagatcccagaaatacagaaggaatctctggaccagtttgactgcaagttgttgaac
cctacacttcaaaaaattaatgataagcgcagaaaggatcatttcaaacgtctcattgct
ggctgtattgggaaacctttgggagaacagttccgcaaggaggttcacattaagaatctt
ccatcgctcttcaaaaaaacaaaaccactgctggagtgtgatgtgctagaaaatgaggat
ggatgcttgagcaccatttttgaaccttga

DBGET integrated database retrieval system