KEGG   Monodelphis domestica (opossum): 100012056Help
Entry
100012056         CDS       T01031                                 

Gene name
PLCZ1
Definition
(RefSeq) phospholipase C zeta 1
  KO
K05861  phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00562  Inositol phosphate metabolism
mdo01100  Metabolic pathways
mdo04020  Calcium signaling pathway
mdo04070  Phosphatidylinositol signaling system
mdo04114  Oocyte meiosis
mdo04919  Thyroid hormone signaling pathway
Module
mdo_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100012056 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100012056 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    100012056 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100012056 (PLCZ1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100012056 (PLCZ1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100012056 (PLCZ1)
Membrane trafficking [BR:mdo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100012056 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like C2 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_10 GDPD
Motif
Other DBs
NCBI-GeneID: 100012056
NCBI-ProteinID: XP_007503649
Ensembl: ENSMODG00000017890
Position
8
AA seq 644 aa AA seqDB search
MENRWFLSIIQEDFRAGRISLEKTVKLLEKLNIRCDGNHVKNVFKENDKQKNGKITIEDF
RAIYRSFAYREDIVEIFNVYSRNHKILSEQNLMEFLKKEQYVLEIDKVIANEIIQKYEPI
EEVKNQHQMTIEGFLRYMNSNDCLLFKKNCTQVYHDMTRPLSDYFISSSHNTYLISGQLI
GPSDLWGYASALVKGCRCIEIDCWDGSQNEPVVYHGYTLTSKILFKTVIQVINKYAFMAS
EYPVVLSLENHCSPQQQEIMANNMQSILGDTLLSDVLENFPNELPSPEALKFKILVKNKK
IGTIEETIERIGTNKQGRIVEYEEEEDEEESEEKDNVTTPMLKENKEKELEEKKSIISNF
ISYSKKKKIRKVKLSLELSDLVIYTKAEKFKSFHHAQINQKFNENNSIGELRARKLSKQK
AREFISHTNSFITRIYPKATRTDSSNYIPQEFWNVGCQMVALNFQTPGVPMDLYNGKFLD
NGGCGYLLKPEILRNPKLNFSPSEFKHYNPTILSIRLISGFQLPSTYWNNSLVLIEIYGI
PDDQTKQQTHVIRRNAFDPRWNETFTFTIHAPEMALIRFVAESQSTIGANEFLGQYTLPL
LCMEKDKFLLSAMMSFHYFSLPFKKASQESLTIPLCTYCFTVGA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagatggttcttatctattatacaggaggactttagagctggaagaatcagc
cttgaaaaaacggtgaaattacttgaaaagctaaatatccggtgtgatggtaatcatgtc
aaaaatgtatttaaggaaaatgacaaacagaagaatggaaaaataaccatagaagatttt
agagcaatttatcggagttttgcttacagagaagatattgttgagattttcaatgtttat
tctcgaaatcacaaaattctgtctgaacaaaatctgatggaatttcttaaaaaagaacaa
tatgtgcttgagatagataaagtcattgccaatgaaataattcaaaaatatgaacccatt
gaagaagtgaaaaatcaacaccagatgacaattgaaggatttttaagatacatgaactca
aatgattgcttactatttaaaaagaattgtacccaagtttatcatgatatgactcgtcct
ttaagtgattactttatttcatcttctcataacacctacctgatttctgggcaattaata
gggccaagtgacctttggggctatgcaagtgcccttgtgaaaggatgtcgttgtatagaa
attgactgctgggatggatcacaaaatgaacctgttgtatatcatgggtatacactaaca
agcaagattctgtttaaaactgtcatccaggtgatcaacaagtatgcatttatggcatct
gaatacccagtagtactctctttagaaaatcactgctccccccagcaacaagaaataatg
gcaaataatatgcaaagtattcttggggatacactgctttctgatgtacttgaaaatttt
ccaaatgaattaccttcacctgaggcattgaaattcaaaatactagtaaaaaataagaaa
attggaacaatagaggagacaattgaaagaataggcactaacaaacaaggccggatagta
gaatatgaagaagaggaagatgaggaagagtctgaagaaaaagacaatgttactacacct
atgcttaaagagaacaaagaaaaagaactagaagaaaaaaaatctataataagcaatttc
atttcttattctaagaaaaaaaagattaggaaggtgaaattatccttggagctgtcagat
cttgtcatttacaccaaagctgagaaattcaagagctttcatcatgcccaaattaatcag
aaattcaatgagaataattctattggggagttgcgtgcaagaaaactttccaaacagaaa
gctcgtgaatttatctcacatactaacagtttcattacgagaatatatccaaaggcaacc
agaacggattcttctaattacattcctcaagaattttggaatgtaggatgtcagatggtg
gccttaaatttccaaacccctggagtgcctatggatctgtacaatggaaaatttctagat
aatggtggctgtggatatcttttaaaaccagaaatcctaagaaatccaaaattaaacttc
tctccaagtgaatttaaacattataatccaactatactttcaataaggctcataagtggt
ttccagttgccatctacttattggaataattcactagtgttgatagaaatatatggcatt
ccagatgaccaaacaaagcaacagactcacgtaattagaagaaatgcttttgatccacga
tggaatgaaacattcacatttactatccatgccccagaaatggcactcatacgctttgtt
gctgaaagtcagtctacaataggtgcaaatgaattccttggacagtacacgttaccactg
ctatgcatggaaaaagacaaatttttattgtcagctatgatgtcttttcactacttctca
ttgcctttcaagaaagcctcccaagaaagtctcactattccactctgtacatactgcttc
actgttggagcttaa

DBGET integrated database retrieval system