KEGG   Monodelphis domestica (opossum): 100012192
Entry
100012192         CDS       T01031                                 

Gene name
HLF
Definition
(RefSeq) HLF, PAR bZIP transcription factor
  KO
K09057  hepatic leukemia factor
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100012192 (HLF)
Transcription factors [BR:mdo03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   bZIP/PAR
    100012192 (HLF)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf Cnn_1N
Other DBs
NCBI-GeneID: 100012192
NCBI-ProteinID: XP_001363525
Ensembl: ENSMODG00000014851
UniProt: F7BZ16
Position
2
AA seq 294 aa
MEKMSRPLPLNPTFIPPTYGVLKSLLENPLKLPLHPEDAFGKEKDKKKLDDDNSSPMVPQ
SAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPATSSAP
SVMDLSSRASTSVHPSISSQNCLQSPIRPGQILSTNRNTPSPIDPETIQVPVGYEPDPAD
LALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPEDLKDDKYWARRRKNNMAAKR
SRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
NT seq 885 nt   +upstreamnt  +downstreamnt
atggagaaaatgtcccgcccgctccccctgaaccccacgttcatccctcccacttacggc
gtgctcaagtccctgctggagaaccccctgaagctgcccctgcaccccgaagacgcattt
ggtaaagaaaaagacaagaagaagctggatgatgacaacagtagccctatggtcccccag
tctgctttcttggggcccaccttgtgggacaaaaccctaccctatgacggagatactttc
cagttggaatatatggacttggaagaattcttgtcggaaaatggcatcccccccagcccc
tctcagcatgaccacagcccccacccccctgggctacagccagcaacctcatcggctccc
tctgtcatggacctcagcagccgggcctccacctcagtgcaccccagcatctcctctcag
aactgcctgcagagccccatcagaccaggtcagatattatccacaaaccgcaacacgcca
agtcccattgaccctgagaccatccaggtccccgtgggttatgaaccggacccagctgac
ttggctctgtccagcatccctggccaggaaatgtttgaccctcgaaaacgcaagttctca
gaggaggagctcaagccacagcccatgataaagaaagctcgcaaagtcttcatccctgaa
gatctgaaggacgacaaatactgggcaagacgtagaaagaacaacatggctgccaagcgc
tcccgagacgcccggaggctgaaggagaatcagattgccatacgggcatcattcctggag
aaagagaactcggccctccgtcaggaggtggctgacttgcggaaggagttgggtaaatgc
aagaacatacttgccaagtatgaggccaggcatggccccctgtag

DBGET integrated database retrieval system