KEGG   Monodelphis domestica (opossum): 100012299Help
Entry
100012299         CDS       T01031                                 

Gene name
GFER
Definition
(RefSeq) growth factor, augmenter of liver regeneration
  KO
K17783  mitochondrial FAD-linked sulfhydryl oxidase [EC:1.8.3.2]
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mdo03029]
    100012299 (GFER)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     100012299 (GFER)
Mitochondrial biogenesis [BR:mdo03029]
 Mitochondrial protein import machinery
  Inter membrane space
   Mitochondrial intermembrane space assembly (MIA) complex
    100012299 (GFER)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Evr1_Alr
Motif
Other DBs
NCBI-GeneID: 100012299
NCBI-ProteinID: XP_007499435
Position
6
AA seq 323 aa AA seqDB search
MKAVRSGSVRGSSPRLRSLYKRPSKERSEAQSSPRANGRHKSRTDQRSTLQRSTLLFYWR
KQKSETSSKCSLAEDGKPETDLENTETGAGPRPEAGAVSKAGLGLKLGLGLAWKLREAAY
PSMPWASKMAAPGEGRRFSPASFFSFLPGGARPQETKEQVASETAGADGDATVRKRPCRA
CVDFKTWMKTQKALKTSESDTQVALENKLPADCPLDREELGRNSWAFLHTMAAYYPDCPT
LDQQEEMAQFIHLFSKFFPCDECAEDIRRRLIRNQPDTSSRNRFTQWLCRLHNEVNLKLG
KPAFDCARVDERWRDGWKDGSCD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgttcggtcggggtcggtgaggggctcgtcccctcgccttaggtccctatac
aagcgcccctccaaggagcggtcggaggcccagtccagtccccgggccaatgggcgccac
aaaagcagaactgaccagcgctccacgctacagcgctccacgctactcttctactggagg
aagcagaagagtgagaccagcagcaagtgttcgctcgcagaagatgggaagcctgagact
gacttagagaataccgagacgggggcggggcctcgccccgaagctggggcggtctcaaag
gcgggactggggctgaagctagggttggggctggcctggaagctgagagaggccgcctat
cccagcatgccctgggcatcgaagatggcggcgcccggtgaaggccggcgcttttctccg
gctagcttcttttccttcctgccgggtggcgcgcggccccaagaaaccaaagagcaggtg
gcgtcggagacagctggggccgacggggatgccaccgtgcgaaagcggccctgccgggcc
tgcgtcgacttcaagacgtggatgaagacgcagaaggcgctgaagacctcggaaagcgat
acccaggtcgcgttggaaaacaagttgccagctgattgccccctggatcgggaggagctg
gggcgaaacagttgggctttcttacatacaatggctgcatattatcctgactgccctacc
ttagaccagcaggaagaaatggcccagtttatacatctgttttccaagtttttcccatgt
gatgagtgtgctgaagatataaggagaaggttgatcagaaaccagccagacaccagcagt
cggaacaggtttacccagtggctctgccgcctacacaacgaggtgaacttgaagctaggg
aagcctgcgtttgactgtgctcgtgtggatgagcgatggcgggatggctggaaggacggc
tcttgtgattag

DBGET integrated database retrieval system