KEGG   Monodelphis domestica (opossum): 100012349Help
Entry
100012349         CDS       T01031                                 

Gene name
OAT
Definition
(RefSeq) ornithine aminotransferase
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00330  Arginine and proline metabolism
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    100012349 (OAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mdo01007]
    100012349 (OAT)
Enzymes [BR:mdo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     100012349 (OAT)
Amino acid related enzymes [BR:mdo01007]
 Aminotransferase (transaminase)
  Class III
   100012349 (OAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 100012349
NCBI-ProteinID: XP_001363028
Ensembl: ENSMODG00000016579
UniProt: F7D3B5
Position
1
AA seq 439 aa AA seqDB search
MFSKLANVQTLAVLRRGVHASGAAAASVATKKTVQGPPSSEQIFEREAKYGAHNYHPLPV
ALERGKGIYVWDVEGRKYFDFLSAYSAVNQGHSHPKIVDALKSQADTLALTSRAFYNNVL
GEYEEYITKMFNYNKVLPMNTGVEAGETACKLARKWAYSVKGIQRYKAKIIFAAGNFWGR
TLSAISSSTDPSSYEGFGPFVPGFEIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVIV
PDPGYLSGVRDLCTKFQVLFIADEIQTGLARTGRWLAVDHENVRPDIVLLGKALSGGLYP
VSAVLCDDEIMLSIKPGEHGSTYGGNPLACRVAMAALEVLEEENLAKNADLMGTLLRNEL
MKLPSDIVTAVRGKGLLNAVVIRETKDYNAWKVCLRLRDNGLLAKPTHGHIIRLAPPLVI
KEDEIRESVEIINKTILSF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttttccaagctggccaacgtgcagactctggctgtgcttcggcgcggcgttcacgcc
tctggggctgccgccgcgtctgtggccaccaagaagaccgtgcagggccctccgagctcc
gagcagatatttgagcgagaggccaagtatggggcccacaactaccatcctctgcccgtc
gccctggaaagaggcaaagggatctacgtgtgggacgtggaaggcaggaagtacttcgac
ttcctgagcgcctacagcgccgtcaaccaggggcacagccaccccaagatcgtggacgcc
ctcaagagccaggcggacacgctggccctgacgtcgcgggccttctacaacaacgtgctg
ggcgagtacgaggagtacatcaccaagatgttcaactacaacaaggtgctgcccatgaac
acaggggtggaagctggagaaacggcctgcaaattagctcgcaaatgggcctacagcgtg
aagggcattcagaggtacaaggcgaagattatttttgcagctgggaacttctggggtcgg
actttatctgccatctctagttcaacggatccatcaagctatgaaggctttgggccattt
gtgccaggctttgagatcatcccctacaatgatctgcctgcccttgagcgtgcactccag
gatcccaacgtggcggccttcatggtggagcccattcaaggggaggccggcgtcatcgtc
cctgatccgggctatctctccggagtcagagatctctgcaccaagttccaggttctcttc
attgctgatgagatacagacgggattagccagaaccgggcggtggctggccgtggatcac
gagaatgtccggcccgacatcgtcctcctgggaaaggccctttctggcggcttgtaccca
gtatcggctgtgctctgcgacgatgaaattatgctgagcattaaaccaggcgaacacggc
tcgacttacggcgggaaccccctggcctgccgcgtggccatggcagctctggaggttttg
gaagaggagaacctggctaagaacgcagacctgatggggaccctcctaaggaacgagctg
atgaagctgccgtctgacatcgtgactgccgtgagaggaaaagggctgctgaatgccgtc
gttatccgagagactaaagattacaatgcctggaaggtgtgcctgcgtctccgcgacaac
gggctcctggccaagcccacccacggccacatcatccggctggcgccgcccctcgtgatc
aaggaagatgagatccgggagtcggtggagatcatcaacaagaccatcctgtctttctga

DBGET integrated database retrieval system