KEGG   Monodelphis domestica (gray short-tailed opossum): 100012394
Entry
100012394         CDS       T01031                                 
Symbol
F9
Name
(RefSeq) coagulation factor IX
  KO
K01321  coagulation factor IX (Christmas factor) [EC:3.4.21.22]
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100012394 (F9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mdo01002]
    100012394 (F9)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.22  coagulation factor IXa
     100012394 (F9)
Peptidases and inhibitors [BR:mdo01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100012394 (F9)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition Trypsin_2 DUF1986 EGF cEGF
Other DBs
NCBI-GeneID: 100012394
NCBI-ProteinID: XP_007507427
Ensembl: ENSMODG00000014012
UniProt: F6VQC9
Position
X:45426714..45473538
AA seq 455 aa
MTGLLFLLIICCSGYLFGAEGAVFLDHENATKILNRPKRYNSGKLEEFVQGNLERECKEE
KCSFEEAREVFENTEKANEFWNQYVDGNQCMSNPCLNGGVCKDGTNAYECWCRGGYEGKN
CEIDASCSIKNGGCKQFCKMNKLNKAVCHCTTGYRLAEDQKSCEPEVPYPCGRVSVPLNL
KKFTRAESIFVNMDNVNSTEEEQVPNEATQITPIHKELSRVVGGEDAKKGEIPWQVILNG
KIKGFCGGSIINEKWIVTAAHCIEPGDEITVVAGEHNIETEEGTEQTRRVIRAIPHHTYN
ATINKYSNDIALLELDEPLQLNEYVTPICIADKEYTNIFLKFGKGTVSGWGKIYHRGRSA
TVLQVLNVPFVDRATCLHSTKVTILNNMFCAGYHQGGKDACQGDSGGPHTTEVEGTSFLT
GIISWGEECALENKYGIYTKVSRYVNWIKEKTKRT
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgactggcctcctgttcctcctgatcatctgctgctcagggtatctttttggtgctgaa
ggtgcagtttttcttgaccatgaaaatgccaccaagattcttaatcggccaaagaggtat
aattcaggtaaactggaagaatttgttcaaggaaaccttgaaagagaatgcaaagaagaa
aaatgtagttttgaagaagctcgagaagtttttgaaaacacagaaaaggcgaatgaattt
tggaatcagtatgtggatggtaatcagtgcatgtccaatccctgcttaaatggaggtgtg
tgcaaggacggaaccaatgcctatgagtgctggtgccgaggcggatatgaaggaaagaac
tgtgaaatagatgccagctgtagcattaaaaatggtggctgcaagcaattctgcaagatg
aataagttgaacaaggcagtgtgtcactgtactacgggataccgactggcagaagaccaa
aagtcctgtgaaccagaagtaccatatccttgtggaagagtgtcagttcctttaaatctt
aagaaattcacccgtgctgagagcatcttcgtcaacatggacaatgtaaactctaccgag
gaggaacaggttcccaatgaagccacacaaatcacgcccatacataaagaattgagtcgg
gtcgttggtggagaagatgccaagaagggagagatcccttggcaggtcattttgaatgga
aagattaaagggttctgtggtggctccatcatcaatgagaagtggattgtaactgcagcc
cactgcattgaacctggggatgaaattactgtggttgcaggcgagcataatattgagact
gaagaaggaactgagcagacaagacgtgtgatccgagctatccctcaccacacctacaat
gccaccatcaataagtatagcaatgatatcgcccttctggagctggatgaacctttgcag
ctaaacgagtacgtgaccccgatctgcattgcagacaaggagtacaccaacatcttcctc
aagtttggaaaaggcaccgtgagtggctggggcaagatctaccacaggggccgctcggcc
accgtcctccaggtcctcaatgttccctttgtggacagagccacatgtctgcattccacc
aaggtcaccatccttaacaacatgttctgtgctggctatcaccagggtggcaaagacgcc
tgccaaggagacagcggggggcctcataccacagaagtggaaggcaccagcttcctcact
ggcatcatcagctggggagaagaatgcgccttggaaaataagtatggcatctatacgaag
gtctcccgctatgtcaactggattaaagagaaaacaaaacgcacctaa

DBGET integrated database retrieval system