KEGG   Monodelphis domestica (opossum): 100012668Help
Entry
100012668         CDS       T01031                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase-like
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00140  Steroid hormone biosynthesis
mdo01100  Metabolic pathways
mdo04913  Ovarian steroidogenesis
mdo04925  Aldosterone synthesis and secretion
mdo04927  Cortisol synthesis and secretion
mdo04934  Cushing syndrome
Module
mdo_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
mdo_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100012668
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100012668
   04925 Aldosterone synthesis and secretion
    100012668
   04927 Cortisol synthesis and secretion
    100012668
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100012668
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     100012668
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     100012668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind NmrA KR
Motif
Other DBs
NCBI-GeneID: 100012668
NCBI-ProteinID: XP_007485350
Position
2
AA seq 377 aa AA seqDB search
MLPTDRWSCLVTGAGGFLGQRIVRLLLEEEKELEEIRVLDKFFSPQLLLEFSELKHKTKV
TVLEGDILDEQFVHKACQGISAVIHTACIIDTGICIKKEVIMKVNLKGTQLLLEACISAN
VPVFLHTSTLEVAGPNSFIKHVRNGHEGEPLETKWSNAYPYSKKLAEKTILAANGQLLRN
GATMHTCALRPMYIYGEGSQLLQDQIIRALDNDKTFIRNKEGAQANPVYVGNVAWAHVLA
LRTLQDSEKAQSIGGQFYYISDDTPHQSYSEFNYEMTKEWGFKLGSKIGIPLTFLYWAAF
LLEMISFMLGPIFMYEPPFNRHLLTLTNSIFTFSYKKAQKDFGYKPRFSWLEAKQKTSQW
IGTLVAQNSEYQKTKTP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccacggatagatggagctgtctcgtgacaggagcaggaggatttctgggtcag
aggattgtccgtctattgctggaggaagaaaaagaactagaagagattcgagtcctggac
aaattcttcagccctcagttgctattggaattttcagagctcaagcacaaaaccaaagtg
actgtgctggaaggagatattctagatgagcagttcgtccataaagcctgccagggcatc
tctgctgtcattcacactgcatgcatcattgacacaggaatatgtatcaagaaagaggtc
atcatgaaagtcaatctgaaaggtactcaactcctcttagaagcctgcatttcagctaac
gtgcctgtgttcctccataccagcactctggaagtggctggccccaactcatttataaag
catgtacgaaatgggcatgagggtgaaccccttgaaaccaaatggtccaatgcatatccc
tatagcaagaagctggctgagaagactatattggcagctaatgggcaacttcttagaaat
ggtgccaccatgcacacctgtgctttaagacccatgtatatatatggggaagggagccaa
ttgctccaagatcaaataatcagagccctagataatgataagacctttataaggaataag
gagggtgcccaggccaacccagtctatgttggaaatgttgcttgggcacatgtcctggca
ctcagaaccctgcaagactctgagaaggcccaaagcattgggggtcagttctattacatt
tctgatgatacacctcaccagagctattctgagtttaactatgaaatgaccaaggaatgg
ggcttcaaacttggatcaaaaataggcattcctttaacattcctatattgggcagccttc
ctgttagagatgataagtttcatgctaggccccattttcatgtatgaacctccctttaac
cgccatctgctaacattgactaacagtatttttaccttctcctacaagaaggcccagaaa
gattttggttataagcctcgcttcagctggctagaagccaagcaaaaaaccagtcagtgg
ataggcacactggtggcacagaacagtgagtaccagaagacaaagaccccctga

DBGET integrated database retrieval system