KEGG   Monodelphis domestica (gray short-tailed opossum): 100012876
Entry
100012876         CDS       T01031                                 
Symbol
CD36
Name
(RefSeq) CD36 molecule
  KO
K06259  CD36 antigen
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo03320  PPAR signaling pathway
mdo04145  Phagosome
mdo04152  AMPK signaling pathway
mdo04512  ECM-receptor interaction
mdo04640  Hematopoietic cell lineage
mdo04920  Adipocytokine signaling pathway
mdo04931  Insulin resistance
mdo04975  Fat digestion and absorption
mdo04979  Cholesterol metabolism
mdo05144  Malaria
mdo05415  Diabetic cardiomyopathy
mdo05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100012876 (CD36)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100012876 (CD36)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100012876 (CD36)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100012876 (CD36)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100012876 (CD36)
   03320 PPAR signaling pathway
    100012876 (CD36)
  09154 Digestive system
   04975 Fat digestion and absorption
    100012876 (CD36)
   04979 Cholesterol metabolism
    100012876 (CD36)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    100012876 (CD36)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100012876 (CD36)
   05415 Diabetic cardiomyopathy
    100012876 (CD36)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100012876 (CD36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdo04131]
    100012876 (CD36)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100012876 (CD36)
   04090 CD molecules [BR:mdo04090]
    100012876 (CD36)
Membrane trafficking [BR:mdo04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    100012876 (CD36)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100012876 (CD36)
CD molecules [BR:mdo04090]
 Proteins
  100012876 (CD36)
SSDB
Motif
Pfam: CD36 PorA
Other DBs
NCBI-GeneID: 100012876
NCBI-ProteinID: XP_001364375
Ensembl: ENSMODG00000017083
UniProt: F6VKJ7
Position
8:complement(149035981..149159255)
AA seq 471 aa
MGCDRNCGLITGAVIGGVLAVLGGILMPVGDMIVQNTIKKECVIEDGTIAYKNWVKTGTE
VYRQFWIFDVQNPEEVMINSTKLKVKQRGPYTYRVRYLAKENLTQNSDNTISFVQPNGAI
FERRLSVGTENDSFTVLNLAVAAAPILYPNSFVQMVLNSFIKKSHSSMFQVRTLKELLWG
YKDPFLSLVPYPIDTTVGVFYPYNNTVDGVYKVYNGKDDISKVAIIDTYKDKKNLSFWPG
YCDMINGTDAASFPPFVEKTRILRFFSSDICRSIYAEFEHEVNLKGIPVYRFVLPSKAFA
SPTVNPDNDCFCTEKIISKNCTSAGVLDISTCKDRKPVYISLPHFLHASPDVPEPIEGLN
PNEEEHRTYLDVEPITGFTLQFAKRLQVNILVKPVKKIDTLSKLKRNYLIPILWLNETGT
IGDEKAEMFRKQVTGKISLLGLVEMVLLTVGIVTFVASMIAYCVCRSKKVK
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgggttgtgatcggaactgtgggctcatcacaggtgccgtcataggtggagtactggct
gtactgggaggcatactaatgcctgttggagacatgattgttcagaacacaattaaaaag
gaatgtgtcattgaagacggtacaattgcttataaaaattgggttaaaacaggcacagaa
gtttacagacagttttggatatttgatgtgcaaaatccggaggaggtgatgattaatagt
acaaaactaaaagttaagcaaaggggtccctatacgtacagggtccgctacctagccaag
gaaaatctaactcagaactcagacaacacaatttcttttgtgcagcccaatggtgccatt
tttgaacgtcgcctctctgttgggacagaaaatgacagctttactgtcctgaatcttgct
gttgcagctgcacccattctctatccaaattccttcgtccagatggtattaaactcattt
atcaagaagtcacactcctctatgttccaagtccgaaccttgaaagaactattgtggggc
tataaagatccatttctgagtttggttccatatcctattgataccacagttggtgtattc
tatccttacaacaatacggtagatggagtttacaaagtttacaatggaaaagatgacatt
agcaaagttgccataattgacacctataaagataaaaagaatctctccttttggccgggt
tactgtgacatgatcaatggcacggatgcagcatcatttcctccttttgtggagaagacc
aggatattgaggttcttttcctctgatatttgcaggtcaatatatgctgaatttgaacat
gaggttaatctgaaagggatcccagtctaccgatttgtccttccatctaaggcatttgca
tcacctactgtaaatccagataatgattgtttctgcactgaaaaaattatctcaaagaac
tgcacctcagctggtgttctggacattagcacctgcaaagacagaaagccagtgtatatt
tcacttcctcactttctacatgcaagccctgatgtgccagaacctattgaggggttaaat
ccaaatgaagaggagcatcggacatatttggatgttgaacctatcactggatttactttg
caatttgcaaaacgactacaggttaacatacttgttaaacctgtaaaaaaaattgatact
ttaagtaaattgaaaaggaactaccttatcccaattctttggcttaatgagactggtacc
attggtgatgagaaagctgaaatgttcagaaaacaagtcactggcaaaataagccttttg
ggtctggtagaaatggttttactcactgttggcatcgtgacctttgttgcatccatgatt
gcatattgtgtatgcaggtcaaagaaagtgaaataa

DBGET integrated database retrieval system