KEGG   Monodelphis domestica (opossum): 100012881Help
Entry
100012881         CDS       T01031                                 

Gene name
DNASE2B
Definition
(RefSeq) deoxyribonuclease 2 beta
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100012881 (DNASE2B)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     100012881 (DNASE2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II PX
Motif
Other DBs
NCBI-GeneID: 100012881
NCBI-ProteinID: XP_001367258
Ensembl: ENSMODG00000000513
UniProt: F6Y5N6
Position
2
AA seq 355 aa AA seqDB search
MTARLLSVGFTVLFLSSCVPPGAARISCRNEDGDAVDWFAFYKLPQNREQKNPSTGLEYM
YLDPMTHRWRRSQGLVNMTQSILGRTLQQLYEAHEAKNNRTAYLIYNDNAPRSVDYSWKQ
GHAKGFLLWDKSQGFWLIHTIPRFPPFPEEGYSYPSTGKKYGQIGICITYNYSQFVEIDS
QLLSCMPNIYSCSIPATFHPELTYLPKLCARSRIPRIPHRRLSRLQSIKGQNFLHFAKSP
YFVDDIYVTWMAQQLQTNLLVETWQPKLPSNCSLPYYVYNIKQIRMSGQFAFSSYYDHAK
WCVSQRYKRHWTCIGDLNRSPFQTRRGGGFICTQNKHIYLAFRGLILHYQNCNQS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaagattattaagcgtgggcttcactgtgctctttctgagctcctgtgtgccc
ccaggggcagctcgaatttcttgcagaaatgaagatggtgatgctgtagattggtttgcc
ttttataagttaccccagaacagagaacagaaaaacccaagcactggattagagtacatg
tacctggatcctatgactcacagatggcggaggagccagggactagtcaatatgacccag
agcatcttaggaaggacattacagcagctttatgaagcacatgaagctaagaacaacaga
actgcctacctgatatataatgacaatgcccctcggtctgtggattacagctggaagcaa
gggcatgcaaaaggtttcttactttgggataaatctcagggattctggctgattcacaca
attccccggtttcctccttttcctgaagaaggctatagctatccatctactgggaagaaa
tatggacaaattggtatctgcataacttacaactacagccagtttgtagaaatagattcc
cagctattaagctgcatgccaaatatttatagctgctccatacctgccacctttcaccca
gaactcacctatctgcctaaactgtgtgcccgctcccggatccccaggattcctcaccgg
cgcctctccagacttcaatccatcaaaggccaaaacttcctgcattttgcaaaatcacct
tactttgtggatgatatctatgtgacttggatggctcaacagttgcagaccaatttgctc
gtagaaacttggcaaccaaagcttccatctaattgttctcttccgtactatgtttataat
atcaaacaaatcaggatgtcaggacagtttgcttttagctcttactatgaccatgccaaa
tggtgtgtttcccaaagatacaagaggcactggacatgcattggcgacctgaaccggagc
ccattccagactcggaggggaggaggatttatttgtacccaaaataagcacatctatctt
gcatttagaggtttgattctgcactaccagaattgcaatcagtcttaa

DBGET integrated database retrieval system