KEGG   Monodelphis domestica (opossum): 100012915Help
Entry
100012915         CDS       T01031                                 

Gene name
CPT1A
Definition
(RefSeq) carnitine palmitoyltransferase 1A
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00071  Fatty acid degradation
mdo01212  Fatty acid metabolism
mdo03320  PPAR signaling pathway
mdo04152  AMPK signaling pathway
mdo04714  Thermogenesis
mdo04920  Adipocytokine signaling pathway
mdo04922  Glucagon signaling pathway
mdo04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100012915 (CPT1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100012915 (CPT1A)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100012915 (CPT1A)
   04920 Adipocytokine signaling pathway
    100012915 (CPT1A)
   03320 PPAR signaling pathway
    100012915 (CPT1A)
  09159 Environmental adaptation
   04714 Thermogenesis
    100012915 (CPT1A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100012915 (CPT1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mdo03029]
    100012915 (CPT1A)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100012915 (CPT1A)
Mitochondrial biogenesis [BR:mdo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100012915 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 100012915
NCBI-ProteinID: XP_001363149
Ensembl: ENSMODG00000003995
Position
5
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQIYLSGLHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMSTMYAKVDPSLGIIAKINQTLDMTGSMSSQTKNIVSGILFGTGLWVTLIV
AMRYSLKMLLSYHGWMFAEYGKLSRGTRIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVK
DTVNRYLESVQPLLNKDNFQRMKGLAEDFSTNLGPRLQWYLKLKSWWATNYVSDWWEEYI
YLRGRSPIMVNSNYYAMDLLYILPTTIQAARAGNAIHSILLYRKKLDREELKPILLLGST
VPLCSAQWERMFNTSRIPGEETDTIQHVKDSRHIVVYHRGRYFKVWLYHDGRLLKPREIE
QQMQRILDDPSEPQAGEEKLAALTAGDRVPWAKARQTYFSRGKNKQSLDAVEKAAFFVTM
DDTEQGYSKKDPLTSMDSYAKSLLHGKCYDRWFDKTFTFIVFKNGKMGLNAEHSWADAPI
VGHLWEYVMATDCFQLGYTEDGHCKGDTNPNIPYPTRLQWEIPEECQDVIEESLSLASTL
ANDVDFHSFPFDAFGKELIKKSRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTMESCNFVLAMVNPTESVENKLKLLRIAAEKHQHMYRLAMTGAGIDRHLFCL
YVVSKYLAVDSPFLKEVLSDPWRLSTSQTPQQQVELFNLERNPEYVSSGGGFGPVADDGY
GVSYIIVGENLINFHVSSKFSSPETDSHRFGNHLKQAMIDIITLFGLQTNDQK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagctcaccaagccgtagcatttcagttcacggtcactcctgacggaatcgac
ctgcgcctgagtcatgaagccctgaagcagatttacctctctggcctccactcgtggaag
aagaagttcatcagattcaagaatgggatcatcacgggcgtctatcccgccagcccgtcc
agttggctcattgtggtggtgggcgtgatgtcaaccatgtatgccaaagtggatccttcc
ttaggaataatagcgaagatcaatcaaaccctcgacatgacagggtccatgtccagccag
accaagaacatcgtcagcggcatcctctttggcacggggctctgggtcaccctcatcgtc
gccatgaggtactccctgaagatgctgctgtcctaccacggctggatgtttgccgagtac
ggcaagctgagccgcggcaccaggatctggatgggaatggtgaagattttctcaggccgc
aaaccaatgctgtacagttttcagacatccctgcctcgcctcccggtgcccgctgttaaa
gatactgtcaacaggtacctggaatcagtgcagcctctgctgaacaaagacaactttcag
agaatgaagggtctcgctgaagatttctccactaaccttggcccgagactgcagtggtat
ctgaagctgaaatcgtggtgggccacgaactacgtcagtgactggtgggaagagtacatc
tacctcagaggacgaagccccatcatggtgaacagcaactactacgccatggatctgctg
tacatcttgcccaccaccatccaggctgctcgggcgggcaacgccatccactccatcctg
ctgtaccggaagaagctggaccgggaggagctcaaaccaattctcctgctgggctccacc
gtcccgctgtgctcggcgcagtgggagcgcatgttcaacacgtctcggatcccgggagaa
gagacggacaccatccagcatgtgaaggacagccggcacatcgtggtgtaccaccgaggc
cgctacttcaaggtctggctctaccatgacgggcggctgctgaagccgcgcgagattgag
cagcagatgcagaggatcctggacgacccctcggagcctcaggccggcgaggagaagctg
gccgccctcactgcgggcgacagagtgccttgggccaaggctcgccaaacatatttttcc
cggggaaagaacaagcagtctctggatgccgttgagaaagcggcgttctttgtgacgatg
gatgacactgagcagggctacagcaagaaggacccgctcacctccatggacagctatgcc
aagtctctgctccacggcaagtgctatgacaggtggttcgacaaaacgttcacattcatc
gtcttcaagaatggcaaaatgggcctgaacgcggagcactcgtgggccgacgcgcccatc
gtcggtcatctgtgggagtatgtgatggctacagattgcttccagctgggctacacagaa
gatggtcactgcaagggagacaccaatcccaacattccataccccaccaggctccagtgg
gaaatccctgaagaatgtcaagacgtcattgaggagtccctgagcctcgccagcaccctg
gccaatgacgtggatttccactcttttccttttgatgctttcggcaaagagttaatcaag
aaaagcaggaccagcccggatgcctttgtgcagcttgccctacagctggcccattataag
gacatgggcaaattctgcttgacatacgaagcttccatgacccgcctcttccgagagggc
cggacggagaccgtccgttcctgtacgatggagtcctgcaactttgtgctcgccatggtg
aaccccacagagtcggttgaaaataagctcaaattattaagaatcgcagctgagaaacac
cagcacatgtatcgtcttgccatgactggtgctggcatcgaccgccatcttttttgcctt
tatgtggtatccaaatatctggctgttgattctcctttcctgaaagaagttttatctgac
ccatggagactgtcaaccagtcagacacctcaacagcaggtagagctctttaatctagaa
agaaatccagaatacgtgtccagtggaggcggctttggaccggttgctgacgacggttat
ggggtgtcctatattatagtgggggagaacctcatcaatttccatgtgtcctccaagttc
tccagccctgagactgattctcatcggttcggaaatcacctgaagcaagccatgatcgac
atcatcaccttgtttggactgcagaccaacgaccaaaagtaa

DBGET integrated database retrieval system