KEGG   Monodelphis domestica (gray short-tailed opossum): 100013281
Entry
100013281         CDS       T01031                                 
Symbol
ABCA3
Name
(RefSeq) ATP binding cassette subfamily A member 3
  KO
K05643  ATP-binding cassette, subfamily A (ABC1), member 3
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    100013281 (ABCA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mdo02000]
    100013281 (ABCA3)
Transporters [BR:mdo02000]
 ABC transporters, eukaryotic type
  ABCA (ABC1) subfamily
   ABCA1, 2, 3, 4, 7, 12, 13 subgroups
    100013281 (ABCA3)
SSDB
Motif
Pfam: ABC_tran ABC2_membrane_3 AAA_21 AAA_23 AAA_15 RsgA_GTPase AAA_29 DUF4898
Other DBs
NCBI-GeneID: 100013281
NCBI-ProteinID: XP_007499475
Ensembl: ENSMODG00000015843
UniProt: F6PJ24
Position
6:complement(157748506..157885830)
AA seq 1706 aa
MALFRQFTLLLWKNYTLKKRKIVVTVLEILLPLLFSGILIWLRQNIHSENIPNATIYPGQ
SISDLPLFFNFPPPEDSWELVYVPSNSEAVKTITEMAKKTLVIDMKVRGFPSEKDFEDYI
KFNNHSYNVLAAIVFEHNFNYYKEPLPLEVKYHLRFSYFRKNDMWAGMTFFFPREIEGWH
TTSLFPLFPNPGPREPSFPDGGEPGYIREGFLAVQHAVDKAIIQYHASTAATRLFEKVTI
IAKRFPYPPFISDSFLVAIQYQLPLLLMLSFTYSTLTIIRAIVQEKERKLKEYMRIMGLS
NWLHWSAWFLTFFLLLLFTIFFMTMLFCIKVEEDIAVITNSDPSLVFVFLMCFAISSISF
SFMVSTFFNKANLAAAIGGFLYFFTYIPYFFIGPRYNWMTLNQKLSSCLFSNVAMALGAQ
LIGKFEAKGIGIQWKYLMKSVNVDDNFTFGHVLIMLLFDSAFYGLVTWYVEAVFPGEYGM
PQPWYFFLMPSYWCGNQRSSIGKEEEDDDPEKVLKTEYIEAEPEDLVAGIKIKHLSKMFM
VRNKRKEAIRDLTLNMYEGQITVLLGHNGAGKTTTLSILTGLFPPTSGRAYINGYEISHD
IVQIRKSLGLCPQHDVLFDYMTVAEHLYFYAQMKGLSEQKCPEEVNHILNILDLENKRHS
LSKSLSGGMKRKVSVGIALIGGSKVVMLDEPTSGMDPISRRATWDLLQQQKNDRTIVLTT
HFMDEADLLGDRIAIMAKGDLQCCGSSLFLKHKYGAGYHMIIVKELHCNTSEISRLVYHH
IPNAILESNVGAELSFILPKESAHRFEILFTELELKQKELGIASYGASVTTMEEVFLRVG
KLVDSSMDIQAIQLPALQYQHERRASDWAMDNNLSGIMDLTDSIGALIKEDCTSIKFNTR
FYLHCQQFYAMFTKKTLYSWRNWKILVAQILVPLTCITLALMAINYSSAIRDDPILQLTL
DQYGQTIVPFSIYGTSKLDQQLSERFKDMLQAEKQVPREVLGDLEEFLIFRASVEGEGFN
ERCLVAASFKDVRDQTVITALFNNQAYHSPATALAIVDNILFKLLSGPSASITVSNYPQP
RGASQTTTEQADEGHTGFHLALNLLFSMAFLASTFSILAVIERDMKAKHIQFVSGVYVIH
FWLSALLWDLLTFLVSCSLLLVVFRAFNVEVFTQDNHLADALMILMLYGWSIIPLMYLMS
FFFSGAAAAYTRLSIFNILSGLATFLIISILRMPGLKLLQLSKTLDMVFLALPSHSLGMS
ISNFFENFETKKYCTSSEIAAHNCKKFNIKYQENFFAWKAPGIGKYMTSMAVSGFVFLIL
LFLIETNLLWRLRTLVSGIFRTRNWAQMHVQAPVITKDQDVEDEKKKVLESLPELLLNTP
LVINDLTKVYSQRMPFLAVDRISLTVQKGECFGLLGFNGAGKTTTFKMLTGEDTITFGDA
FVDGYSIITDIKKVRQRIGYCPQFDALLEHMTGRETLIMYARLRGIPEGHISNCVKNVLQ
GLLLEPHADKLVKTYSGGNKRKLSTGIALIGEPSVIFLDEPSTGMDPVARRLLWDTVTRA
RESGKAIVITSHSMEECDALCTRLTMMVNGQFKCLGSPQHLKSKFGSGYTLLAKVKSDRQ
EGKMEALELFKMFINQTFPGSILKDEHQGMVHYHLPSKDLSWAKVFGILEKAKEKYGLDD
YSISQVSLEQVFMSFAHLQSSGEDER
NT seq 5121 nt   +upstreamnt  +downstreamnt
atggctctgttcaggcagtttacacttcttctttggaagaactacaccttaaagaagcgg
aagattgtagtaacagtcttggaaattctcctgcctttgctgttttctgggatactaatt
tggcttcgccagaatattcactcagaaaacattcccaatgctaccatataccctggccag
tccatcagtgacctgcccttgtttttcaactttcctcccccagaagactcatgggagctg
gtttatgttccttccaacagtgaggctgtgaagactatcactgagatggcaaaaaagact
ttagtcatcgatatgaaagttcgtggttttccctcagaaaaggattttgaagattacatt
aagtttaataatcactcttacaatgtactggctgctatcgtgtttgagcacaacttcaat
tattacaaggaacccctgccacttgaggttaagtaccacttacgcttcagttactttcga
aagaatgatatgtgggctgggatgactttcttttttccaagagagattgaaggatggcac
actacctctctctttccacttttcccgaatccaggacctagagaaccctcattccctgac
ggaggagaacctggatacatccgagaaggattcctggctgttcagcatgcagtggataaa
gccattattcagtaccatgcaagcactgccgcaaccagactgtttgagaaagtcaccatt
attgcaaagaggttcccatacccaccattcatttcagattcttttctggttgccatccag
taccagcttcctttactgctcatgctgagctttacttactccacactcaccatcatccgt
gccattgtacaagaaaaggaaagaaaattgaaggagtacatgcgcatcatgggactcagc
aactggcttcactggagtgcctggttcctcacattcttcttactcctgctttttactatc
ttttttatgaccatgcttttctgtattaaggtggaagaggacattgcagtgatcacaaac
agtgatccttctttggtgtttgtctttttgatgtgttttgccatttcttccatctccttc
agttttatggtcagcaccttcttcaataaagccaatttggcagctgctataggtggtttc
ctctatttctttacatatattccttacttcttcattggtcctcgatataactggatgacc
ctcaaccaaaagttatcttcctgtctcttctcaaatgttgccatggcattgggggcccag
cttataggcaagtttgaagcaaaaggaataggaattcaatggaaatatcttatgaaatca
gttaatgtcgatgataacttcacttttgggcacgtgttgataatgctgctatttgattct
gccttctatggtttggtgacttggtatgtggaagctgtatttccaggagaatatggtatg
cctcagccctggtattttttcttgatgccttcctactggtgtgggaaccaaagatcttcg
atagggaaagaggaagaagatgatgatcctgagaaagttctaaaaacagagtacattgag
gctgaacctgaagatttagtagctggcataaagattaagcatctgtccaagatgtttatg
gtgaggaataagagaaaagaggcaataagagacctgactttgaatatgtacgaggggcag
atcactgttctcctaggacataatggagcagggaagaccaccaccctgtccatcctcaca
ggtctttttcctcctacaagtggacgggcatatatcaatgggtatgagatctcacatgac
atagttcagatcaggaagagcctgggcttatgcccccagcatgatgtcctctttgactat
atgacagtggctgaacacctttatttctatgctcagatgaaaggattatctgaacagaaa
tgtcctgaggaagtcaatcatatcttgaacattcttgatctggagaataaacgccactcg
ctttcaaagtcactaagtggaggaatgaaacgcaaggtctctgttggcatcgcactcata
ggaggctcaaaggtagtgatgctagatgaaccaacttcaggaatggatccaatttcacgg
agagccacctgggatctccttcaacagcagaaaaatgaccgcaccattgtgctgaccaca
cacttcatggatgaagctgacctcttgggggaccgaattgctattatggccaaaggggac
ctgcagtgttgtggctcatcacttttcctcaagcacaaatatggtgcagggtatcatatg
atcatagtgaaggaactccattgtaacaccagtgaaatttctcgtctggtttatcatcat
ataccaaatgccattttggagagcaacgttggagctgaattatcatttatcctccccaag
gagagtgcacataggtttgaaattctatttactgaattggaactgaaacagaaagagcta
ggtattgccagctatggtgcatctgttaccaccatggaagaagtcttccttagagttggc
aagcttgtagattcaagtatggatatccaagccatacaacttcctgccttgcagtaccag
catgagagacgggcaagtgactgggccatggataacaacctcagtggaatcatggacctt
actgacagcattggagccttaatcaaggaagattgtacttccatcaaatttaacaccagg
ttctaccttcattgccagcaattctatgccatgttcacaaagaaaaccttgtacagctgg
cgcaactggaagatcctggtggcacaaatccttgtgcctctgacttgcatcacattagcc
ctcatggccatcaactactcctcagccattcgagatgaccccatcttacaattaaccttg
gatcaatatggtcagacaattgtgcccttttccatctatggaacctccaaactggatcag
cagctttcagaacgctttaaagatatgctgcaggctgagaaacaggtcccccgggaagtg
ttaggtgatttggaagagttcctgatttttagggcctcagtagaaggtgaaggctttaat
gaacgatgccttgtggcagcttccttcaaagatgttagagaccaaacagttatcactgct
ctgttcaacaaccaagcctaccactctcctgccactgctctggccatcgtggacaatatt
ctgttcaagctgctttctggccccagtgcttccattactgtctctaactaccctcaacct
cgaggtgccagccagaccacaacagaacaagctgatgaaggccacacaggatttcatcta
gctcttaatttgctcttcagtatggctttcttagccagtacattttccatcctggcagtc
attgagagagacatgaaggcaaagcatatccagtttgtcagtggagtctatgtcattcat
ttttggctttctgccttgctgtgggatctccttaccttccttgtctcctgttcactgctg
ctggtggtgttcagagcctttaatgtggaagttttcacccaggataaccaccttgcagat
gctctgatgattttaatgctctatggttggtccatcattcctctcatgtacctgatgagc
ttctttttttctggagctgcagctgcctacactagactcagcatattcaacatcctctca
ggccttgccacctttcttatcatcagcatcttgcgcatgccaggactcaaattgttgcaa
ctttctaaaaccttggacatggttttcctggcattgcccagtcacagcttagggatgtct
ataagcaatttttttgaaaactttgagaccaagaaatactgcacatcttctgagattgca
gcccataactgcaagaaatttaatattaaataccaagagaatttctttgcatggaaagct
cctgggattgggaaatacatgacttctatggctgtttctggctttgttttcctcattctt
ctattcctcattgaaactaacctcctctggagactgagaactttggtcagcggcatcttc
aggacacggaattgggcacagatgcatgttcaagcaccagtgattacaaaagaccaagat
gtagaagatgaaaaaaagaaagtcctggaatctcttccagagctgttgctgaatacccca
ttggtcattaacgatctcacaaaggtgtacagccagaggatgcccttcctagctgtggac
agaatctccctcacagtccagaagggagagtgttttggactgctgggcttcaatggagct
gggaaaaccaccaccttcaaaatgctgactggggaagacaccattacctttggagatgcc
tttgttgatggttacagcatcatcactgacatcaaaaaggtacgacagcgaataggctac
tgccctcagtttgatgccttgttggaacacatgactggacgagagactctgatcatgtat
gcccggctacggggcatccctgagggccatattagcaactgtgtgaagaacgtgctgcag
ggcctgctcctggaacctcatgcagacaaactcgtcaagacttacagtggtggcaataag
cgtaagctgagcacggggattgccttgattggagagccttcagtcatcttcctagatgag
ccatccactggcatggacccggtagctcggcgcctgctctgggatacagtgactcgggcc
cgggaatctggcaaggccattgtcatcacctcccacagcatggaagagtgtgatgccttg
tgcacccggttgaccatgatggtgaatgggcaattcaagtgcctgggcagcccacaacat
ctcaagagcaagtttgggagcggctacaccctcttggccaaggttaaaagcgaccggcaa
gagggcaaaatggaggccctagagctgttcaagatgtttatcaaccagactttcccaggg
agcatcctgaaggatgaacaccaaggaatggtccattatcacctgcccagtaaggacctc
agctgggcaaaggtatttggcatcttggagaaagccaaagagaaatatggactagacgac
tattccatcagtcaagtctcactggagcaagtcttcatgagctttgcccacttacaatct
tcaggagaagatgaacgatga

DBGET integrated database retrieval system