KEGG   Monodelphis domestica (gray short-tailed opossum): 100013981
Entry
100013981         CDS       T01031                                 
Symbol
KLKB1
Name
(RefSeq) plasma kallikrein
  KO
K01324  plasma kallikrein [EC:3.4.21.34]
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100013981 (KLKB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mdo01002]
    100013981 (KLKB1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.34  plasma kallikrein
     100013981 (KLKB1)
Peptidases and inhibitors [BR:mdo01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100013981 (KLKB1)
SSDB
Motif
Pfam: Trypsin PAN_1 PAN_4 Trypsin_2 MANEC PAN_2
Other DBs
NCBI-GeneID: 100013981
NCBI-ProteinID: XP_007496092
Ensembl: ENSMODG00000004972
UniProt: F7FL16
Position
5:complement(78614074..78643840)
AA seq 630 aa
MFFPCQAVFFLFFFATVTSECVTQLYENTFFKGGDVGAVYTPTAKHCQKVCTFHPRCILF
SFLPANSIDDEKKRFGCFLKDSITGTLPRVTRRNAFSGHSLKLCSNRPSICNKEKYEGLD
MRGENFNITKVNTVEECEKQCTNHVLCHFYTYATQTFYNPQFRNTCLLKHSPSGTPSAIK
MADGLVSGFSLKPCGLSNMGCSTTIFQHLSFSGENVGSVIAPDRSVCRTICTYHPNCLFF
TFYTSNWHIESQRNMCFLMTSNSGKPSSKIPQDNAESGYSLLNCEDVTGLKSLTSRVQCH
WNFYHGMDFEGDKLEDVYVHGPEACQQSCTNTIRCQFFTYTSLRGECKEDKCKCSLKISS
DGAPTRIIHGTEGISGYTLRLCKTPSISVCPTFTGRIVGGKPSSLKEWPWQVSLQVKLRT
QSHVCGGSIIGDQWVLTAAHCFDGLSSPDIWRIYSGILNQSEIQADTPFSRAKEIIIHHQ
YEISEIGHDIAIIKLDTPLNCTDSQSSICLPSEENTYQDCWVTGWGYTQEKGEIQNTLLK
ANIPLISNEECQKKYLQYKVTDHMICADDKEGGKDSCKGDSGGPLSCIHNGKWKLVGITS
WGDGCGQKDHPGVYTKVTAYLDWILENTRN
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgtttttcccatgccaagcagtgtttttccttttcttctttgctacggtgaccagtgaa
tgtgttacgcaactttatgaaaacaccttcttcaaaggaggagatgtgggtgcggtatac
accccaactgctaaacattgccagaaagtgtgcaccttccaccccaggtgtattctgttt
agctttctaccggcaaactccattgatgatgagaaaaaaagatttggttgcttcttaaaa
gacagcattaccggaacccttccaagagtgactagaagaaatgctttttctgggcattct
ttaaaactatgtagtaaccgaccaagtatttgtaacaaggagaagtatgaagggctcgac
atgagaggagagaatttcaatataaccaaggtgaacactgttgaagaatgcgaaaaacaa
tgtacaaaccatgtcttatgccacttttacacatatgccacacaaacgttctacaacccg
cagtttcgaaatacatgtttgctgaagcacagcccgtcaggaacccccagtgctatcaag
atggcagatggcttggtgtcaggattctccctgaagccctgtggactttctaatatgggt
tgctcaacgactatttttcaacatctctcattttctggtgaaaatgttggcagtgtgatt
gccccagatcgttctgtatgccgtactatttgtacctaccatcctaattgcttatttttt
acattctatacaagcaattggcatatagaatcacaaagaaatatgtgttttcttatgaca
tcaaacagtggaaaaccaagttctaaaataccacaggacaatgctgagtcaggatatagt
cttctaaactgcgaggatgtgactgggctcaagtctttgactagtagagttcaatgccat
tggaatttttatcatggtatggactttgaaggggataagttggaagatgtctatgttcat
gggcctgaagcttgtcaacaaagttgtacaaacacaatccgatgtcagttttttacatat
acaagcctcagaggagaatgcaaggaagacaagtgtaaatgttccttaaaaatatcttca
gatggtgccccaactagaataatacatggcacagaaggtatttctggttatactttaaga
ctatgtaaaactccaagtatctctgtttgcccaacattcactggaagaattgttggagga
aagccatcttctctgaaagaatggccatggcaagtctccttacaagtcaaactgagaaca
cagagtcatgtatgcggaggctcaatcattggggaccagtgggtcttaacagcagcccat
tgctttgatggcctatcatcacctgatatttggagaatttattctggcattttaaatcaa
tcagaaatacaggcagacactcctttctccagagcaaaggagattattattcaccatcaa
tatgaaatttcagaaataggacatgatattgccataataaagcttgacactcccttgaat
tgcactgattcccaaagttcgatctgcttgccttcagaagaaaatacatatcaggactgc
tgggtgactggatggggttatacccaggaaaaaggtgaaattcaaaataccctcctgaag
gctaatattcccctaatatctaatgaagaatgccagaaaaagtacctacaatataaagta
acagatcacatgatctgtgctgatgataaagaagggggtaaagattcttgtaagggagat
tcaggtggtcccttgtcttgtattcataatggaaaatggaagctagttggcatcaccagc
tggggagatgggtgtggtcaaaaggatcacccaggggtttacaccaaagtgactgcatat
ttggactggatcctggagaacacccgaaactga

DBGET integrated database retrieval system