KEGG   Monodelphis domestica (opossum): 100014031Help
Entry
100014031         CDS       T01031                                 

Gene name
CYLD
Definition
(RefSeq) CYLD lysine 63 deubiquitinase
  KO
K08601  ubiquitin thioesterase [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04217  Necroptosis
mdo04380  Osteoclast differentiation
mdo04622  RIG-I-like receptor signaling pathway
mdo04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Cell growth and death
   04217 Necroptosis
    100014031 (CYLD)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100014031 (CYLD)
   04625 C-type lectin receptor signaling pathway
    100014031 (CYLD)
  Development
   04380 Osteoclast differentiation
    100014031 (CYLD)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100014031 (CYLD)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C67
   100014031 (CYLD)
Ubiquitin system [BR:mdo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100014031 (CYLD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CYLD_phos_site CAP_GLY UCH COX_ARM zf-HIT
Motif
Other DBs
NCBI-GeneID: 100014031
NCBI-ProteinID: XP_001363603
Ensembl: ENSMODG00000013111
UniProt: F7BMW7
Position
1
AA seq 956 aa AA seqDB search
MNSGLWSQEKVTSPYLEERIFYLLLQECSVSDKQTQKIIKVPKGSIGQYVQDRSLSHARI
PLSKGKKNHIGLKILEQPHAVLFVDEKDVVEISEKFTELLLAITNCEERFSLFKNRSRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLTERTVSGIFFGVELLEEGRGQGFTDGI
YQGKQLFRCDEDCGVFVALDKLELIEDDDSTLESDYAGPIDMMQVELPPLEINSRVSLKV
GEGIESGTVIFCDVLPGKENLGYFVGVDMDNPIGNWDGRFNGIQLCSFASVESTLLLHIN
DIIPALSDSVTQERRPPKLAFMPRGGGDKALSSHSKPKATGSTSDPGNRSRSELFYTLNG
GSVDSQPQIKSKNTWYSDEVAEDPAKSLTDISSDFGHSSPPLQPPSINSSANENRFHSLP
FSLTKMPNTNGGIGHSPLSLSVQSVIGELNNSPVQESPPLTVPSSNSHGLEVGSLAEVKD
NPPFFGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKCCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEVMIGKKKGIQGHYNS
CYLDSTLFCLFSFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDL
LEDTPRQCRICGGLAMYECRECYDDSDISAGKIKQFCKTCNTQVHLHPKRLSHKYNPVSL
PKDLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGRDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSVEELHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaggcttatggagccaagaaaaagttacttcaccttacttggaagaacgaatt
ttttacttgcttctgcaagaatgcagtgtttcagacaaacaaacacaaaagattattaaa
gtacctaaaggaagcataggacaatatgttcaagatcgttctttgagccatgcaagaatt
cctctttctaaaggcaagaaaaatcatattggattaaaaattttggaacagccacatgca
gtcttatttgtggatgagaaggatgttgtagaaataagtgaaaaattcacagaattgctt
ttggccattaccaattgtgaggaaagattcagtctgtttaaaaacagaagcagactaagt
aaaggcctccaaatagatgtgggatgccctgtgaaagtacagctgagatctggggaagaa
aaatttcctggagttgtacgcttcagaggacctttgttaacggagaggacagtgtcggga
atattctttggcgtagaattgctggaagaaggtcggggtcaaggtttcactgatggaatt
taccaagggaaacaacttttccggtgtgatgaagattgtggtgtctttgtggctttggac
aaattagagcttatagaagatgatgacagtacattggaaagtgattatgcaggcccgatt
gacatgatgcaggttgaacttcctcctttggaaataaattccagagtttctttgaaggtt
ggcgaaggtatagaatctggaacagttatattctgtgatgtcttgccaggaaaagagaat
ttaggatactttgttggagttgatatggataatcctattggaaattgggatggaagattc
aatggaatacaactttgtagttttgcaagtgtggaaagtacacttttgttgcatatcaat
gatattataccagctttatcagatagtgtgacacaagaaagaaggcctcccaaacttgca
tttatgccaagaggtggtggggataaagctttatccagtcatagtaaaccaaaggctaca
ggatctacctcagaccctggaaatagaagcagatctgaattattttacacgttaaatggt
ggttctgttgattctcaaccacaaatcaaatcaaaaaacacttggtacagtgatgaagtt
gctgaagatcctgcaaaatccctaacagatatatcatcagattttggacattcttcacca
cctctgcagcctccttctataaactcttccgccaatgagaacagatttcactctttacca
tttagcttgacaaagatgccaaataccaatggaggtattgggcatagtcctctatctctc
tctgttcagtcggtgataggagagctaaacaactctccggtccaggagagtccacctttg
actgtaccttcaagtaattcacatggtcttgaagtaggctcattggctgaagttaaagat
aatcctcctttctttggtgtaatacgttggattggtcagccaccaggactaaatgaagta
ttagcaggactggaactggaagacgaatgtgcaggctgtacagatggaactttcagaggt
acgcgttatttcacctgtgccctaaagaaggcgctgttcgttaaactcaagtgctgcagg
cctgattctaggttcgcctcacttcagccagtttccaaccagattgaacggtgcaactct
ttagcatttggaggttacttaagtgaagtggtagaagagaatactccaccaaaaatggaa
aaagaaggtttagaggtaatgattggaaagaagaaaggtatccagggccattacaattct
tgttacttagactctaccttattctgcttattttcttttagttctgttctggacactgtc
ttacttagacctaaagaaaagaatgatgtagaatattatagtgaaactcaagaactactg
aggacagaaattgtaaatcctcttagaatatatggatatgtttgtgccacaaaaattatg
aaactgagaaaaatacttgagaaagttgaggctgcatcaggttttacctctgaagaaaaa
gatcctgaagagttcttgaacatcctgtttcatcatatcttgagggtagaaccattatta
aagataagatctgcaggacaaaaggtacaagattgttatttctatcaaatttttatggaa
aaaaatgaaaaagttggtgttcctacaattcaacagctgctagaatggtctttcatcaat
agtaacctaaaattcgcagaggcaccatcatgtctgattattcagatgcctcgatttgga
aaagacttcaaactcttcaaaaaaatttttccttcactggaattaaatataacagattta
cttgaagatactcccagacagtgccggatatgtggaggacttgctatgtatgaatgcaga
gaatgctatgatgattctgacatttctgctgggaaaatcaagcagttttgtaaaacctgc
aacacacaagtccaccttcatcccaagaggttaagtcataaatacaatccagtgtcactt
cccaaagacttgcctgactgggactggagacatggctgtataccttgtcagaagatggag
ttgtttgctgttctctgcattgaaacaagccattatgttgcttttgtaaagtatgggcga
gatgactcagcctggctcttctttgacagcatggctgaccgtgatggtggtcagaatggc
tttaacattcctcaagttaccccatgcccagaagtcggggagtacttgaaaatgtcagta
gaagaactgcattccctggactccaggagaatccaaggctgtgctagaagacttctttgt
gatgcatatatgtgcatgtatcaaagtccaacaatgagtttgtacaagtaa

DBGET integrated database retrieval system