KEGG   Monodelphis domestica (opossum): 100014165Help
Entry
100014165         CDS       T01031                                 

Gene name
CDK18
Definition
(RefSeq) cyclin dependent kinase 18
  KO
K15596  cyclin-dependent kinase 18 [EC:2.7.11.22]
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdo01001]
    100014165 (CDK18)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100014165 (CDK18)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100014165 (CDK18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 100014165
NCBI-ProteinID: XP_007481769
Ensembl: ENSMODG00000001795
Position
2
AA seq 443 aa AA seqDB search
MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLNSRRSESLAQGHLQLGPLVGDFQPE
PSAISPSEEDGDSHSQSSPGIRYRKHNQRRFSMEDVSKRLSLPMDIRLPPEFLQKLQLES
PELPKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRL
EHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTERSLTLVFEYLDSDLKHYLDHCGNLM
SMHNVKVFMFQLLRGLSYCHRRKILHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTY
SNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPMFPGSTVKEELHLIFRLL
GELDTDGIDLLTSLPLYEAKSRISAEEALRHPYFGPLGERVHQLPDTASIFSLKEIQLQK
DPGYRGLSFQQTGRGKNRRQSIF
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaataagatgaagaatttcaagcgtcgattctccctctcagtgccccgaacagagacc
atagaggaatctctggctgaattcactgagcagttcaaccaacttaacagccgacggagc
gaaagcttggcccaagggcaccttcagcttggccctctagtaggagacttccagcctgag
cccagtgccatctcaccatcagaggaggatggggacagccacagccagtcctcacctggt
attcgttaccgaaaacacaaccagcgtcgcttctccatggaggatgtcagcaaacggctc
tccctgcccatggacatccgcctgccgcccgagtttctgcagaagctgcagctggagagc
ccggaactcccgaagcctctgagcagaatgtcccgccgggcatccctatctgatatcggc
tttgggaaactggaaacttatgtgaaactggacaagttaggtgagggcacctatgccacc
gtcttcaaagggcgaagcaaactcactgagaacctggtggcactgaaggaaatccgtctg
gagcatgaggagggtgccccttgcactgccatccgggaagtgtcgctgctgaaaaactta
aaacatgccaacattgtgaccctgcatgacctgatccacacggaacggtcccttaccctc
gtctttgagtacctggacagtgacttgaagcactacttggaccactgcggaaacctcatg
agcatgcacaatgtcaaggtctttatgttccagctgctccgaggtctctcttactgccac
cgacggaagatccttcacagggacctgaagccccagaacttgctcatcaacgagaagggg
gagctaaaactggcagacttcggcctggctcgggccaagtcagtgcccaccaagacttac
tccaatgaagtagtgaccctttggtaccggccccctgacgtgctgctgggctctacggaa
tactctactcccatcgatatgtggggtgtgggctgcatccactatgagatggccactgga
aggcccatgttccctggctccactgtcaaagaagaattgcaccttatcttccgcctgctt
ggtgagttggacacagacggcattgacctacttaccagcctccctctgtatgaagccaag
agccggatctctgcagaggaagccctgagacacccttactttgggcccctgggggagcgt
gtgcaccaactccctgacactgcctccatcttctctctaaaggaaattcagctccagaag
gacccaggttaccggggcttatccttccagcagacaggccgagggaagaaccggagacaa
agcatcttctga

DBGET integrated database retrieval system