KEGG   Monodelphis domestica (opossum): 100014536
Entry
100014536         CDS       T01031                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00230  Purine metabolism
mdo00240  Pyrimidine metabolism
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100014536 (DCK)
   00240 Pyrimidine metabolism
    100014536 (DCK)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100014536 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 DUF932 CoaE
Other DBs
NCBI-GeneID: 100014536
NCBI-ProteinID: XP_001364586
Ensembl: ENSMODG00000019092
UniProt: F7FN05
Position
5
AA seq 260 aa
MATPPKRSCPSPANEAGRTRIKKIAIEGNIAAGKSTFVNILKQVSDDWEVVPEPVARWCN
VQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLSAVNGKFKEAE
KPVVFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLHRIFLRGREEEQEIPLEYLEKLHYKHESWLQNRTLKTNFDYLREIPVLTLDITE
DFKDKYENLVEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggctaccccgcccaagaggagctgtccgtctcccgccaacgaagcggggaggactcgc
atcaagaagatcgccatcgaaggcaacatcgctgcagggaaatcaacatttgtaaatatc
cttaagcaagtctctgatgattgggaagtggttcctgagcctgttgccaggtggtgcaat
gttcagagcacgcaggatgaatttgaggaactgacaacttctcagaaaagcggtgggaat
gtgcttcagatgatgtatgaaaaaccagaacgatggtcattcaccttccagacctatgcc
tgcttgagcaggatacgagctcaactctctgctgtaaatgggaagttcaaagaggctgag
aagcctgtggtgttctttgagcgctctgtatatagtgacaggtatatttttgcatctaac
ttatatgagtctgattgcatgaatgaaacagaatggacaatttatcaagactggcatgac
tggatgaataaccagtttggtcagagtcttgaactggatgggataatttatctccgagcc
actccagagaaatgtttacatagaatattcttgaggggaagagaagaagaacaagaaatt
cctctggaatacttggaaaaactgcattataaacatgaaagttggctccagaatagaaca
ctgaaaaccaactttgattatctgcgagagatacctgtcttaacattggacattactgaa
gattttaaggacaaatatgaaaatcttgttgaaaaggtcaaggaatttttgagcactttg
taa

DBGET integrated database retrieval system