KEGG   Monodelphis domestica (opossum): 100014567
Entry
100014567         CDS       T01031                                 

Gene name
SLC4A4
Definition
(RefSeq) solute carrier family 4 member 4
  KO
K13575  solute carrier family 4 (sodium bicarbonate cotransporter), member 4
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04964  Proximal tubule bicarbonate reclamation
mdo04972  Pancreatic secretion
mdo04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100014567 (SLC4A4)
   04976 Bile secretion
    100014567 (SLC4A4)
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100014567 (SLC4A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mdo02000]
    100014567 (SLC4A4)
Transporters [BR:mdo02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   100014567 (SLC4A4)
SSDB
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 Fmp27_WPPW VWA_N
Other DBs
NCBI-GeneID: 100014567
NCBI-ProteinID: XP_001364648
Ensembl: ENSMODG00000019098
Position
5
AA seq 1106 aa
MNGSLQQINLPRSWAASSGSLQEKSEHSFFLFYYYRMEDEAVLDRGASFLKHVCDEEEVE
GHHTIYIGVHVPKSYRRRRRHKRKAGHRERREKERNSENYSDKSDVENADESSSSILKPL
ISPAAERIRFILGEDDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGER
WSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDNQIETGLLKADLKDKV
TYTLLRKHRHQTKKSNLRSLADIGKTVSSASSPAMTPRNLTSSSLNDISDKPEKDQLKNK
FMKKLPRDAEASNVLVGEVDFLESPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGK
AKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPTIRIEP
PKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHGDSEELQRTGRFCGGLIKDIKRK
APFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATENMQGVLESFLGTAVSGA
IFCLFAGQPLTILSSTGPVLVFERLLFNFSKDNGFDYLEFRLWIGLWSAFLCLILVATDA
SFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSHFKVDYITHFTCACLPPE
GANESTFGDTTSSPIDLLMPTSTVMSHNATIDWASLSKKECLKYGGELMGNSCKYVPDIT
LMSFILFLGTYTCSMALKKFKTSRYFPTMARKLISDFAIILSILIFCIIDALVGVDTPKL
IVPSEFKPTSPNRGWFVPPFGGNPWWVYLAAAIPALLVTILIFMDQQITAVIVNRKEHKL
KKGAGYHLDLFWVAVLMIVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGV
REQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPL
KHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYL
FSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIME
QQPFLSDNKPADREKSPTFLERHTSC
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgaacggcagcttgcagcagattaacctgcccaggagctgggctgcttctagtggttca
ctccaggagaaatctgagcattcgttttttcttttttattactataggatggaggatgaa
gccgtcctggacagaggggcttccttcctgaaacatgtgtgtgatgaagaagaagttgaa
ggtcaccacaccatctacattggggttcatgtaccgaagagctatcgaaggcggcggcgc
cacaagaggaaggcaggccatagggaaaggagggagaaggaaagaaactcagagaactat
tctgacaaatctgatgtggagaatgcagatgagtcaagcagtagcatcctcaaaccactc
atctctccggcagccgagcgtatccgcttcatcctgggggaggacgatgacagcccggcg
ccccctcagctcttcactgaattggatgagctcctggcagtggatgggcaggagatggaa
tggaaagagacagccaggtggatcaagtttgaagagaaagtggaacaaggtggagagaga
tggagcaaacctcatgtggccacgctgtccttacacagtttatttgaactgaggacatgc
atggagaagggatcaataatgctggatcgggaagcttcctctctccctcagttggtagag
atgattgttgacaatcagatcgagacgggtctcttgaaagctgacctgaaggataaagtg
acctacactttgctccggaagcatcggcatcagactaagaaatccaatctccgatcattg
gctgacattgggaagaccgtctccagtgcaagtagcccagccatgactcctaggaatttg
acttcttcaagcttgaatgacatttctgacaaaccagagaaggaccagttaaagaataag
ttcatgaagaaacttccccgtgatgcagaggcctccaatgtcctggttggggaagtggac
ttcctggagagtccgttcattgcctttgtacgattgcagcaggctgtcatgctgggcgcc
ttgactgaggttccagtgcccacaaggttcctgttcattctcttgggtcctaagggaaag
gccaagtcttatcatgagattggcagagccattgctactttgatgtctgatgaggtgttc
catgatattgcttacaaagcaaaggataggcaagacctgattgctggaattgatgagttc
ttggatgaagtcatcgtccttcccccaggggaatgggatccaaccattaggatagagcct
ccaaagagtcttccatcatcagacaaaaggaagaatatgtactcaggtggagagaatgtg
caaatgaatggagataccccccatgatggaggtcatggagggggagggcatggggactct
gaagaactccagcgaacaggaaggttctgtggaggactaattaaggacataaagaggaaa
gcacccttttttgccagtgacttttatgatgctttaaatatccaagctctttccgccatc
cttttcatttatctggcgacagttaccaacgcgatcactttcggtggactgctgggggat
gccacggaaaacatgcagggtgtcttggagagcttcctgggcacagcagtctctggagcc
atcttttgtctttttgctggccaaccactcactatcttgagcagcacaggacctgtcctc
gtctttgagagacttttatttaatttcagcaaagacaatggttttgactatctggaattc
cgtttgtggatcggtctgtggtccgccttcctgtgtctcatcctggtggccacggatgcc
agcttcttggtgcagtactttacccgattcactgaagagggtttctcctccctgattagc
ttcattttcatctatgatgcattcaagaagatgatcaagctggctgattactatcctatt
aattcccacttcaaagtggactacatcactcatttcacttgtgcctgtttgcctccagaa
ggagccaatgagtcgacttttggtgacacgacctcttctcccatagatttattgatgcct
acttctactgttatgtctcataatgccaccattgactgggcatcattgtccaagaaggag
tgtttgaagtatggtggggagctcatgggcaacagctgcaaatatgttcctgatatcaca
cttatgtcctttatcctcttccttggtacatacacatgttctatggccctgaagaagttc
aaaactagtcgctactttcccactatggcaagaaaacttattagtgactttgccattatc
ctgtccatcctcattttttgtattatcgatgccttggtaggtgtggacactccaaaacta
attgtgccaagtgaattcaagccaacaagtcccaatcgaggctggtttgttccacccttt
ggagggaacccctggtgggtgtaccttgcagctgctattcctgccttgctggtcaccatt
ctgattttcatggaccaacaaatcacagctgttattgtcaatagaaaagaacataaactc
aagaagggagctggctatcatctggatctcttctgggtagccgttcttatgatagtatgt
tctttcatggctctcccctggtatgtggccgctactgtcatctccattgctcacatcgac
agtttgaagatggagacggagacatctgcacctggagaacaacccaagtttctaggagtc
agggaacaaagagtcactggaactcttgtgtttattctgactggtctgtctgtctttatg
gctcccatcttgaagtttattcccatgcctgtactctatggcgtgttcctgtacatgggg
gtcgcatccctgaatggcgtgcagttcatggatcgtctgaagctgcttctgatgcctctc
aagcaccagcctgacttcatctaccttcgccatgtccctctgcgccgtgtgcacctcttt
actttcctccaggtgctctgcttggcccttctctggatcctcaagtccacagtggccgcc
attatctttccagtcatgatactggctcttgtagctgtcagaaaaggcatggactacctc
ttttcccagcatgacctcagttttcttgatgacgtcattccagaaaaggacaagaaaaag
aaggaagatgagaagaaaaagaaaaagaaaaaaggcagtctggatagtgacaatgatgat
tctgactgcccttactccgaaaaagttccaagtattaaaattccaatggacatcatggaa
caacagcctttcctaagtgacaacaaacccgctgacagagaaaagtcaccaacattcctt
gaacgccacacatcatgctga

DBGET integrated database retrieval system