KEGG   Monodelphis domestica (opossum): 100014871Help
Entry
100014871         CDS       T01031                                 

Gene name
MAPKAPK2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04218  Cellular senescence
mdo04370  VEGF signaling pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04722  Neurotrophin signaling pathway
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100014871 (MAPKAPK2)
   04370 VEGF signaling pathway
    100014871 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100014871 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100014871 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100014871 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100014871 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100014871 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mdo01001]
    100014871 (MAPKAPK2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100014871 (MAPKAPK2)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   100014871 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 100014871
NCBI-ProteinID: XP_007481772
Position
2
AA seq 489 aa AA seqDB search
MLSNSPGQTPPVLFPNPPPPPPPQQPQPPSQSQPQPQAPVLPLPPPPPPPPPPQQQSQPP
PPPQPPQQFPQFYVKSSLQIKKNAITDDYKVTSQVLGLGINGKVLQIFNKKTGEKFALKM
LQDCPKARREVDLHWRASQCPHIVKIVDVYENLYAGRKCLLIIMECMDGGELFSRIQDRG
DQAFTEREASDIMKSIGEAIQYLHSINIAHRDVKLLRVSSLPNLIISSFCLKTGFASTFP
RNVWKSSKLIRHIQYLLTDCLFHLDLPSVNFSWNGYNGIPRRMMKRVLTFGPLTAEAQMR
SSLLLLGTYLSPSNLFSFTAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAI
SPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSMQV
PQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDATNPLLLKRRKKAR
ALEAAALAH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctaactcacccggccagaccccgcccgtgctgttccccaatcctccgccgccg
cccccgccccaacagccccagcccccctcccagtcccagccccagcctcaggctccggta
ctacctctgccgccgccgccgcctccgccaccgccgccgcagcagcagtcacagccgccg
ccgcccccccaacccccccaacagtttccccagttctatgtcaagtcgagcctgcagatc
aagaagaatgctatcacggatgactacaaggtcaccagccaggtcctggggctcggcatc
aacgggaaagttttgcagatctttaacaagaagaccggggagaaattcgccctcaaaatg
cttcaggattgccccaaagcccgaagggaggtggatctgcattggcgagcctctcagtgc
ccacacattgtcaagatcgtggatgtctatgagaacctgtatgcaggaaggaagtgtctc
ctgatcatcatggaatgcatggatggtggagagctcttcagccgcatccaagaccgagga
gaccaggccttcacagagagagaggcgtcagacatcatgaagagcatcggtgaagcaatt
cagtacttacactcaatcaacattgctcacagggatgtcaagctgttacgtgtatcttct
cttcctaacttgattataagctccttctgtttgaagactgggtttgcatctacattcccc
cgcaacgtgtggaagagttctaagcttataagacacattcagtacttgttgactgactgc
ctcttccatttggatcttcccagtgtgaatttctcctggaatggatataatggtataccc
aggagaatgatgaagagggtcctcacctttggtcccttgactgctgaggcacagatgagg
agctctctcttgcttctagggacatatctcagtcccagtaacctcttctcttttacagct
ccagaggtcctgggccctgagaaatacgataaatcctgtgacatgtggtctttgggtgtc
atcatgtatatcctactatgtggttatcctccattctattccaaccatggccttgccatc
tctcctggcatgaagacacgaatccggatgggccagtatgagtttcccaatccagagtgg
tcagaagtatcagaggaagtcaaaatgcttatccggaatctgctaaagacagaaccaact
caaagaatgaccatcactgaatttatgaaccatccttggattatgcaatcaatgcaggtc
cctcagactccactgcatacaagcagagtcctaaaggaagacaaggagaggtgggaggat
gtgaaggaagaaatgaccagtgccttggccaccatgcgcgttgactatgagcagatcaag
attaagaagattgaggacgccaccaaccctctgctcctaaagaggcggaagaaggcccgg
gctctggaggcagccgcccttgctcactga

DBGET integrated database retrieval system