KEGG   Monodelphis domestica (gray short-tailed opossum): 100015110
Entry
100015110         CDS       T01031                                 
Symbol
CHST11
Name
(RefSeq) carbohydrate sulfotransferase 11
  KO
K01017  chondroitin 4-sulfotransferase 11 [EC:2.8.2.5]
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    100015110 (CHST11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mdo01003]
    100015110 (CHST11)
Enzymes [BR:mdo01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.5  chondroitin 4-sulfotransferase
     100015110 (CHST11)
Glycosyltransferases [BR:mdo01003]
 Unclassified
  Sulfotransferases
   100015110 (CHST11)
SSDB
Motif
Pfam: Sulfotransfer_2 SelO
Other DBs
NCBI-GeneID: 100015110
NCBI-ProteinID: XP_001365750
Ensembl: ENSMODG00000002117
UniProt: F6UG44
Position
8
AA seq 352 aa
MKPTLFEVMRMNRICRMALVTCLGSFILVIFYFQSMLHPVMRRNPFGMDICCRKGSRSPL
QELYNPTQLELSNTAILHQMRRDQVTDTCRANSVTSRKRRVLTPSDLKHLVVDEDHELIY
CYVPKVACTNWKRVMMVLTGRGKYSDPMEIPANEAHVSGNLKTLNQYSIPEINHRLKNYM
KFLFVREPFERLVSAYRNKFTQKYNTSFHKRYGTKIVKRQRKNATQEALRKGDDVKFEEF
VAYLIDPLTQREEPFNEHWQTVYSLCHPCHIHYDLIGKYETLEDDSNYVLQLAGVGSYLK
FPTYAKSTKTTDEMTTEFFQNISMEHQTQLYDVYKLDFLMFNYSVPSYLKLE
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaagccaaccctgttcgaagtgatgaggatgaaccgcatttgcaggatggctctggtc
acttgcttgggatcctttatcctagtcatcttctatttccaaagtatgttgcatccagtc
atgcggaggaatccctttggaatggacatctgttgtcggaagggctctcggagcccactt
caggaactctacaatccaactcagttggagctctcaaacacggccatcctgcaccagatg
aggcgggatcaagtcacggacacatgtcgggccaacagcgtgaccagcaggaaaagacgc
gtcctgacccccagtgacctcaagcacctggtggtggatgaggaccacgagctgatctat
tgctacgtgcccaaagtcgcttgtacaaactggaagagggtcatgatggtcctcactggg
agggggaaatacagtgaccccatggagatccccgccaacgaagcccacgtctcgggcaac
ctgaagaccctcaaccagtacagcattccagaaatcaaccaccgcttgaaaaactacatg
aaattcctgtttgtccgcgagcccttcgaaaggctggtgtcagcctacaggaacaaattc
acccagaagtacaacacgtcctttcacaagcgatacgggaccaagatcgtcaagcgtcag
aggaagaacgccacccaagaggccctgaggaagggcgacgacgtcaagttcgaggagttt
gtggcgtacctcatcgatccacttacccagagagaggagcctttcaatgaacactggcaa
acggtgtactcgctctgccacccctgccacatccattacgacctcatcggcaagtacgag
accctggaagacgattccaattacgtcctccagctggcgggagtcggcagctacctgaag
ttccccacctatgcaaagtctacgaaaactactgatgaaatgaccacagagttctttcag
aacatcagcatggaacatcaaacgcagctctatgatgtctacaaactggattttttaatg
ttcaattactcagtgccaagctacctgaaactggaatga

DBGET integrated database retrieval system