KEGG   Monodelphis domestica (opossum): 100015722
Entry
100015722         CDS       T01031                                 

Definition
(RefSeq) calmodulin-alpha-like
  KO
K02183  calmodulin
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04020  Calcium signaling pathway
mdo04022  cGMP-PKG signaling pathway
mdo04024  cAMP signaling pathway
mdo04070  Phosphatidylinositol signaling system
mdo04114  Oocyte meiosis
mdo04218  Cellular senescence
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04270  Vascular smooth muscle contraction
mdo04371  Apelin signaling pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04713  Circadian entrainment
mdo04720  Long-term potentiation
mdo04722  Neurotrophin signaling pathway
mdo04728  Dopaminergic synapse
mdo04740  Olfactory transduction
mdo04744  Phototransduction
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04910  Insulin signaling pathway
mdo04912  GnRH signaling pathway
mdo04915  Estrogen signaling pathway
mdo04916  Melanogenesis
mdo04921  Oxytocin signaling pathway
mdo04922  Glucagon signaling pathway
mdo04924  Renin secretion
mdo04925  Aldosterone synthesis and secretion
mdo04970  Salivary secretion
mdo04971  Gastric acid secretion
mdo05010  Alzheimer disease
mdo05012  Parkinson disease
mdo05022  Pathways of neurodegeneration - multiple diseases
mdo05031  Amphetamine addiction
mdo05034  Alcoholism
mdo05133  Pertussis
mdo05152  Tuberculosis
mdo05163  Human cytomegalovirus infection
mdo05167  Kaposi sarcoma-associated herpesvirus infection
mdo05170  Human immunodeficiency virus 1 infection
mdo05200  Pathways in cancer
mdo05214  Glioma
mdo05417  Lipid and atherosclerosis
mdo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100015722
   04015 Rap1 signaling pathway
    100015722
   04371 Apelin signaling pathway
    100015722
   04020 Calcium signaling pathway
    100015722
   04070 Phosphatidylinositol signaling system
    100015722
   04024 cAMP signaling pathway
    100015722
   04022 cGMP-PKG signaling pathway
    100015722
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100015722
   04218 Cellular senescence
    100015722
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100015722
  09152 Endocrine system
   04910 Insulin signaling pathway
    100015722
   04922 Glucagon signaling pathway
    100015722
   04912 GnRH signaling pathway
    100015722
   04915 Estrogen signaling pathway
    100015722
   04921 Oxytocin signaling pathway
    100015722
   04916 Melanogenesis
    100015722
   04924 Renin secretion
    100015722
   04925 Aldosterone synthesis and secretion
    100015722
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100015722
   04270 Vascular smooth muscle contraction
    100015722
  09154 Digestive system
   04970 Salivary secretion
    100015722
   04971 Gastric acid secretion
    100015722
  09156 Nervous system
   04728 Dopaminergic synapse
    100015722
   04720 Long-term potentiation
    100015722
   04722 Neurotrophin signaling pathway
    100015722
  09157 Sensory system
   04744 Phototransduction
    100015722
   04740 Olfactory transduction
    100015722
   04750 Inflammatory mediator regulation of TRP channels
    100015722
  09159 Environmental adaptation
   04713 Circadian entrainment
    100015722
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100015722
  09162 Cancer: specific types
   05214 Glioma
    100015722
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100015722
   05163 Human cytomegalovirus infection
    100015722
   05167 Kaposi sarcoma-associated herpesvirus infection
    100015722
  09171 Infectious disease: bacterial
   05133 Pertussis
    100015722
   05152 Tuberculosis
    100015722
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100015722
   05012 Parkinson disease
    100015722
   05022 Pathways of neurodegeneration - multiple diseases
    100015722
  09165 Substance dependence
   05031 Amphetamine addiction
    100015722
   05034 Alcoholism
    100015722
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100015722
   05418 Fluid shear stress and atherosclerosis
    100015722
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdo01009]
    100015722
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdo04131]
    100015722
   03036 Chromosome and associated proteins [BR:mdo03036]
    100015722
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mdo04147]
    100015722
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100015722
Membrane trafficking [BR:mdo04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    100015722
Chromosome and associated proteins [BR:mdo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     100015722
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100015722
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg Dockerin_1 EF-hand_11 TerB UPF0154 EFhand_Ca_insen Caleosin DUF4497 DUF5580 DUF2267 MecA_N MotA_activ DUF1103 SurA_N_2 GIP1_N Fe_hyd_lg_C LNS2
Other DBs
NCBI-GeneID: 100015722
NCBI-ProteinID: XP_016284770
Ensembl: ENSMODG00000023174
Position
2
AA seq 149 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTSELGTIMRSLGQNPTEAELQDMINEVDTDG
NGTIDFSEFLTMMARKMKDTDSEEEIREAFRVFDKDGDGFISAAELRHVMTNLGEKLTDE
EVDEMIREADMDGDGQVNYEEFVHMMTAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgaccaactaacagaagaacaaattgcagaattcaaagaagccttttcactgttc
gacaaagatggagatggcaccataacaacatcggaactgggtaccataatgaggtcactt
gggcagaaccccaccgaagctgaactacaagacatgatcaatgaagtagacaccgatggc
aacggcacaattgacttttcagaatttctcaccatgatggcccgaaaaatgaaggatacc
gacagtgaagaagaaatcagagaggcgttccgcgtgttcgacaaggacggcgacggtttc
atcagtgccgcagaacttcgacacgtgatgaccaaccttggagagaagttaacagatgag
gaagttgatgaaatgatcagggaagctgacatggatggggatggtcaagtgaactatgaa
gaatttgttcatatgatgacagcaaagtga

DBGET integrated database retrieval system