KEGG   Monodelphis domestica (opossum): 100015779Help
Entry
100015779         CDS       T01031                                 

Definition
(RefSeq) alcohol dehydrogenase class 4 mu/sigma chain
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00071  Fatty acid degradation
mdo00350  Tyrosine metabolism
mdo00830  Retinol metabolism
mdo00980  Metabolism of xenobiotics by cytochrome P450
mdo00982  Drug metabolism - cytochrome P450
mdo01100  Metabolic pathways
mdo05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100015779
  Lipid metabolism
   00071 Fatty acid degradation
    100015779
  Amino acid metabolism
   00350 Tyrosine metabolism
    100015779
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100015779
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100015779
   00982 Drug metabolism - cytochrome P450
    100015779
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100015779
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100015779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N UDPG_MGDP_dh_N 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-GeneID: 100015779
NCBI-ProteinID: XP_007495962
Ensembl: ENSMODG00000020710
Position
5
AA seq 384 aa AA seqDB search
MIFLFVSPGVIISSDIVIKCKAAVLWGLKQPFSIEEVEVAPPKACEVRIKILATGICRTD
EHAISGAMTTKFPVIVGHEATGVVESIGEGVTSVKPGDKVIPLFLPQCGKCSSCINPNGN
LCVKADVTGKGVLSDGTTRFTCKGKPVYHFMNTSTFSEYTVVDESSVTKIDANAPPEKVC
LIGCGFSTGYGAAMKTAKVTPGSTCAVFGLGGVGLSVIMGCKSAGASRIIGIDLNKSKFE
KAKAVGATECISPKDYTKPISEVLSEMTDNSVGYTFEVVGRLETMIDALASCHLSYGTSV
VVGAPPSSKMLTYDPMLLFTGRTWKGCVFGGWKSKDDVPKLVSDFLAKKFDLDQLITHVL
HFKDINEGFELLSQGKSIRSVILM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatttttctattcgtgtctccaggggttatcatatcttcagatatagtgataaaatgc
aaagctgctgtgttgtggggcctaaagcaacccttttccattgaggaagtggaagtcgct
ccaccaaaagcctgtgaagttcgaattaagattttggctacaggaatctgtcgtacagat
gagcatgcaatcagtggtgccatgaccactaaatttccagtaattgtgggacatgaagca
actggagttgtagagagtattggagaaggggtgacttcagtgaaaccaggagacaaggtt
atcccactcttcctgccacaatgtggaaaatgctcctcctgcataaaccctaatggcaat
ttgtgtgtgaaggctgatgttactggcaagggagtgttgtctgatggcaccaccagattt
acctgcaaagggaagccagtctaccacttcatgaacaccagtaccttctctgagtacaca
gtggtagatgaaagttcagttactaaaatcgatgccaatgctcctccagaaaaggtctgt
ctgattggctgtggattctctactggttatggggctgcaatgaagactgccaaggtcacc
cctggatctacatgtgctgtctttgggctaggaggagttggcctctcagttatcatgggc
tgtaaatcagccggtgcttcacgaatcattggaattgacctcaacaaaagcaaatttgag
aaggccaaggctgtaggagccactgagtgcatcagccctaaggactacacaaagcccatc
agtgaagtcctgagtgaaatgactgataattctgtagggtacacatttgaggttgttgga
cgccttgaaaccatgattgatgctctggcttcctgccatttgagctatgggaccagtgtg
gtagtaggagctcccccatcatctaaaatgctcacctatgatcctatgctactgttcact
ggacgcacctggaaaggatgtgtttttggaggttggaaaagcaaagatgatgtcccaaaa
ctagtgtctgattttttggcaaagaaatttgacttggaccagttaataacccatgttttg
catttcaaagacatcaatgaaggatttgaattgctctcccaaggaaagagcattcgatca
gtcattctgatgtga

DBGET integrated database retrieval system