KEGG   Monodelphis domestica (opossum): 100015858Help
Entry
100015858         CDS       T01031                                 

Gene name
ADH7
Definition
(RefSeq) alcohol dehydrogenase class 4 mu/sigma chain
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00071  Fatty acid degradation
mdo00350  Tyrosine metabolism
mdo00830  Retinol metabolism
mdo00980  Metabolism of xenobiotics by cytochrome P450
mdo00982  Drug metabolism - cytochrome P450
mdo01100  Metabolic pathways
mdo05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100015858 (ADH7)
  Lipid metabolism
   00071 Fatty acid degradation
    100015858 (ADH7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100015858 (ADH7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100015858 (ADH7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100015858 (ADH7)
   00982 Drug metabolism - cytochrome P450
    100015858 (ADH7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100015858 (ADH7)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100015858 (ADH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 100015858
NCBI-ProteinID: XP_007495964
Ensembl: ENSMODG00000020712
Position
5
AA seq 396 aa AA seqDB search
MDNSATFQYIYYLLGKVNHKEKRGLPRWVIKCKAAVLWGPKQPFSIEEVEVAPPKAYEVR
IKIIATGICRTDDHAIKGILLANFPVILGHEGAGIVESIGEGVTTVKPGDKVIPLCLPQC
GKCSSCINPNGNFCVKADITGRGVLSDGTSRFTCKGKPVYHFSSTSTFTEYTVVEEIAVT
KIDASAPLEKVCLIGCGFSTGYGAAMKTAKVTPGSTCVVFGLGGVGLSVIIGCKVAGATR
IIGVDLNKDKFEKAKAVGATECISPKDYTKPISEVLKEMTGDSVGYTFEAVGRLETMTDA
LASCHMSYGTSVIVGLPPSATMCTYDPMLLFTGRTWKGSTFGGWKSKDDLPKIVTDFLAK
KFDFDELITHVLPFNEIEEGFNLLYKGESIRAVLVM
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggataactctgctacattccaatacatttattatttacttggaaaagtaaaccataaa
gagaagagaggcctgcctagatgggtgattaagtgcaaagctgctgtgttgtggggccca
aagcaacccttttccattgaggaagtggaagttgccccaccaaaagcttatgaagttcga
attaagattatagccacaggaatctgtcgaacagatgatcatgccatcaagggaatcctg
cttgctaattttccagttattttgggacatgaaggagctggaattgtagagagtattgga
gaaggagtaactacagtaaaaccaggagacaaggtcatcccgctctgtctcccacagtgt
ggaaagtgctcttcttgcataaaccccaatggcaacttctgtgtgaaggctgatattaca
ggtaggggagtattgtctgatggcacctccagatttacctgcaaagggaagccagtgtat
cacttctccagcaccagtaccttcactgagtacacagtggtggaggaaattgcagttact
aagattgatgcttctgctccactagagaaggtctgtttgattggctgtggattctccact
ggttatggggctgcaatgaagactgccaaggtcacccctggatctacttgtgttgtcttt
gggctgggaggagttggcctctccgttattattggctgtaaagtcgccggtgctacccgg
atcattggagttgaccttaacaaagataaatttgagaaggccaaggctgtaggagccact
gagtgcatcagccctaaggactatacaaagcccatcagtgaagtgctgaaggaaatgact
ggcgattctgtggggtacacctttgaggctgttgggcgcctcgaaaccatgaccgatgcc
ctggcttcctgccatatgagctatgggaccagtgtgatagtaggacttccaccatcagct
acaatgtgcacttatgatccaatgctgctatttactggacgcacctggaaaggaagtact
ttcggaggttggaaaagcaaagatgacctccccaaaatagtgactgatttcttagcaaag
aaatttgactttgatgagttaataacccacgttttaccttttaatgaaattgaagaagga
tttaatctgctctacaaaggagagagcattcgagcagttctggtgatgtga

DBGET integrated database retrieval system