KEGG   Monodelphis domestica (opossum): 100016910Help
Entry
100016910         CDS       T01031                                 

Gene name
AMDHD2
Definition
(RefSeq) amidohydrolase domain containing 2
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00520  Amino sugar and nucleotide sugar metabolism
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100016910 (AMDHD2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     100016910 (AMDHD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 100016910
NCBI-ProteinID: XP_016279705
Position
6
AA seq 340 aa AA seqDB search
MVGEGGFGVDFSLPNEDIASGVALVAKKLLSHGVTAFCPTMVTSPSDVYHKVLPNIAVKR
GGPEGAGILGVHLEGPYISREKRGAHPESQIRTFETGAFQDLLATYGSLDNVCIITLAPE
LSRSGEIIQELTSRGICVSVGHSMASLEEAEKAVQNGASFITHLFNAMLPFHHRDPGIVG
LLTSDKIPDEKQVFFGMIADGIHTNPAALRIAHKVHPKGLVLVTDALPALGLGNGQHTLG
QQVVEIKGLKCYVAGTTTLCGSVAPMDVCVRHFFHATDCKMEMALEAASLHPAQLLGIEK
QKGTLNFGSDADFVVLDDSLNVKATYISGDLVWQDSDFSH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggtaggagaaggtggatttggggtggacttctccctgcccaatgaagatatagcttca
ggggttgctttggttgccaagaagctcctatctcatggggttacagcattctgtccaacc
atggtcacctcaccatctgatgtttatcacaaggtccttcctaatattgctgtgaagcgt
ggtggccctgaaggagctgggatccttggggtacatttagaaggaccatatatcagccgt
gagaaacggggggcacatcctgagtcccaaattcgcacctttgagactggtgcattccag
gatttgttggctacttatggatccctggataatgtttgcataataactctggctcctgaa
cttagccgaagtggtgaaatcatccaggagctaacttctcgtggcatctgtgtgtctgta
ggtcactccatggccagcttagaagaggccgaaaaagccgtccagaatggagccagtttt
atcacccacctcttcaatgctatgcttccttttcatcatcgagatcctggcattgtgggt
cttctgactagtgacaagatcccagatgaaaagcaggttttctttggaatgattgcagat
gggatccacacaaaccctgcagccctaaggattgcccacaaggtccatcccaaaggcctt
gttctggttactgatgctcttcctgcccttggcttaggcaatggtcagcacactttgggt
cagcaagttgttgagataaagggactgaaatgctacgtggccggcaccacgacactttgt
ggcagtgtggccccaatggatgtttgtgttcggcactttttccatgccacagactgcaag
atggagatggcactcgaggctgcatccctacacccagcccagctgctagggatagaaaaa
caaaaggggacattgaactttggctcagatgcagatttcgtggtcctcgatgactctctg
aatgttaaggccacttatatttcgggggacttggtgtggcaggacagtgatttcagtcat
tga

DBGET integrated database retrieval system