KEGG   Monodelphis domestica (opossum): 100017110Help
Entry
100017110         CDS       T01031                                 

Gene name
A4GALT
Definition
(RefSeq) alpha 1,4-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00601  Glycosphingolipid biosynthesis - lacto and neolacto series
mdo00603  Glycosphingolipid biosynthesis - globo and isoglobo series
mdo01100  Metabolic pathways
Module
mdo_M00068  Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100017110 (A4GALT)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100017110 (A4GALT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mdo01003]
    100017110 (A4GALT)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     100017110 (A4GALT)
Glycosyltransferases [BR:mdo01003]
 Glycan extension
  P blood group
   100017110 (A4GALT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug HEPN-like_int
Motif
Other DBs
NCBI-GeneID: 100017110
NCBI-ProteinID: XP_007502858
Position
8
AA seq 336 aa AA seqDB search
MAKWRVPVLKCALWAVLLKLAVLVSVTLYWLAEPRLESPLPRVPAGVTCPRAPPGPGGPG
DIFFVETSERTEPGFLFMCSVESASRTHPRASVVVLMKGLAGSNSSLPRNLGVSLLSCFP
NVEFRALDLAGLFQGTPLAGWYASIAHLWQPYLLPVLSDAARIALMWKFGGVYLDTDFIV
LRSLANLSNALGAQSKYMLNGAFLAFEPGHDFIRLCMQDFVDHYNGWVWGXQGPQLVTRV
FKRWCGEKSLREGQSCRGVRALPREAFYPVAWQDWRRYFQDVSFPESRRLLRDTYAVHVW
NKKSQGARFQVTSRVLLARLYSQYCPTTAGAMRAYL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggccaagtggcgggtgcccgtgctgaagtgcgcgctgtgggccgtccttctcaagctc
gcggtcctcgtctccgtcacgctctactggctggcggagccccgactcgagagcccgctg
ccccgcgtgcccgcaggggtcacgtgcccccgcgcccctcccggcccggggggccccggg
gacatcttctttgtggagacttcggagcgcaccgagcccggctttctcttcatgtgctcc
gtggagtcggcctccaggactcacccgcgggccagcgtcgtggtcctcatgaagggcctg
gcggggagcaactcctccctgcccaggaacctgggcgtctccctgctcagctgcttcccc
aacgtggagttccgggccctggacctggccggccttttccagggcacccctctggccggc
tggtacgcgtccatcgcccacctgtggcagccctacctcctccccgtcctgtccgacgcc
gcccggatagccctcatgtggaagttcggaggcgtttatctggacacggacttcatcgtc
ctcaggagcctggcaaacctcagcaacgcgctgggcgcccagtccaagtacatgctcaac
ggggccttcctcgccttcgagcccggccacgacttcatccggctgtgcatgcaggacttc
gtggaccactacaacggctgggtgtggggcncccagggcccccagctcgtcaccagggtc
ttcaaaaggtggtgcggcgagaagagcctgcgcgagggccagagctgccggggcgtccgg
gccctgccccgggaggccttctaccccgtcgcgtggcaggactggaggcgctacttccaa
gacgtcagcttcccagaatcccgcaggctgctgagggacacctacgccgtccacgtgtgg
aacaagaagagccagggcgcccgcttccaggtcacctccagggtgctgctggcccggctc
tactcgcagtactgccccacgacagcgggcgccatgagggcgtatctgtga

DBGET integrated database retrieval system