KEGG   Monodelphis domestica (opossum): 100018106Help
Entry
100018106         CDS       T01031                                 

Gene name
DUSP10
Definition
(RefSeq) dual specificity phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100018106 (DUSP10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdo01009]
    100018106 (DUSP10)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100018106 (DUSP10)
    3.1.3.48  protein-tyrosine-phosphatase
     100018106 (DUSP10)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    100018106 (DUSP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 100018106
NCBI-ProteinID: XP_001367472
Ensembl: ENSMODG00000004672
UniProt: F6U725
Position
2
AA seq 482 aa AA seqDB search
MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLESASSISDHHVAVIATTVVSLKAANLTY
MPSSTCSARSLNCGCSSASCCTVATYDKDNQAQTQAIAAGTSTNIGTSTVCPANQMVNNN
ENLGSLSPSGGVGSPMLGTPKPLASIKIIYPNDLAKKMTKCSKSHQQSQGPVIIDCRPFM
EYNKSHIQGAVHINCSDKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENTN
EPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDSSLQLQECPEGVGGAS
AASSVLPQSLPPTTPDIENAELTPILPCLFLGNEHDAQDLDTMQRLNIGYIINVTTHLPL
YHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVI
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLIGVET
VV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcctccatctcctttagacgacagggtagtagtggcactatctaggccagtccgacct
caggatctcaacctttgtttagactctagctaccttgaatctgcctcttctatcagtgat
caccacgtagccgtgattgccaccaccgttgtgtctctaaaagctgcgaatctgacgtat
atgccctcatccacttgctctgcccgctccctgaattgtggatgcagcagtgccagctgc
tgcactgtggcaacttacgacaaggacaatcaggcccagacccaagccatcgctgccggc
acttccaccaacataggaacctctactgtctgccctgccaaccagatggtcaacaacaat
gaaaatcttggctctttaagtccatcaggtggggtaggcagtcccatgttggggaccccc
aagccattagccagcatcaaaataatctaccccaatgacttggcaaagaagatgaccaaa
tgtagcaaaagtcaccaacagagccagggtcctgtcatcattgactgcagacctttcatg
gaatacaataagagccacatccagggggctgtccatattaactgttctgataaaatcagc
aggaggagattacagcaaggcaagatcacagtcttggacttgatctcctgtagggaaggc
aaggactctttcaagaggatcttttccaaagaaatcatagtttatgatgagaataccaat
gaacccagccgggtgatgccttcccaaccacttcatatagtcctagagtcactgaagaga
gaaggcaaagagcctctggttttgaaaggtggactaagtagttttaagcagaaccatgaa
aacctctgtgatagctccctccagctgcaggagtgcccagagggtgttgggggagcatct
gcagcctccagtgtgctacctcagtcccttccccctacaacccctgacattgagaatgca
gagctaacccccatcttgccctgcttgttcctcggcaatgagcatgatgctcaggacctg
gatactatgcagcgactaaacattggctacatcatcaatgtcaccacccacctccccctc
taccactatgagaagggcctgtttaactacaaacgactgcctgccactgatagcaacaaa
cagaacctgaggcaatactttgaagaggcttttgagttcattgaggaagctcaccagtgt
ggaaaaggactcctcatccattgccaggcaggtgtgtcccgctcggcaaccatcgtcatt
gcctacttaatgaagcacacccggatgaccatgactgatgcttataaatttgtcaaaggc
aaacgaccaattatttcccccaaccttaactttatggggcagttgctggagtttgaggaa
gacctaaataatggagtgacaccaagaatccttacgccaaagctcattggagtggagaca
gttgtgtga

DBGET integrated database retrieval system