KEGG   Monodelphis domestica (opossum): 100018119Help
Entry
100018119         CDS       T01031                                 

Gene name
CREM
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100018119 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100018119 (CREM)
Transcription factors [BR:mdo03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100018119 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 100018119
NCBI-ProteinID: XP_001365987
Ensembl: ENSMODG00000006900
Position
8
AA seq 299 aa AA seqDB search
MSKCGRKKYIKTSIRQMTMETVESQQDGSVTDSVTDNDSAHVQTQTGQNSIPTLAQVATI
AETDESAEAEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEEKSEEEGTPPNIA
TMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQTLTMTNSGAPPPGATIVQYAA
QSADGTQQFFVPGSQVVVQAATGDMPTYQIRTPTTALPQGVVMAASPGSLHSPQQLAEEA
TRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatgtggcaggaaaaaatatattaagacaagtataagacaaatgaccatggaa
acagttgaatctcagcaggatggaagtgtaacagattctgtaacagacaatgattctgcc
catgtacagactcagactggtcaaaattctattccaaccctagctcaggtagcaacaatt
gcagagacagatgagtctgcagaagcagaaggtgtaattgattctcataaacgtagagaa
atcctttcaagaagaccttcatatcgaaaaatactgaatgaactttcatctgatgtgcct
ggtgttcccaagattgaagaagaaaaatccgaggaagaaggaacaccacctaacatcgct
accatggcagtgccaactagcatatatcagactagcacggggcaatacattgctatagcc
caaggtggaacaatccagatttctaatccaggatctgatggtgttcagggactacagaca
ttaacaatgacaaattcaggagctcctccaccaggtgctacaattgtacagtatgcagca
caatcagctgatggcacacagcagttctttgtaccaggcagccaggttgttgtccaagca
gccactggtgacatgccaacttaccagatccgaactcctactactgctttgccacaggga
gtcgtaatggcagcctctccaggaagtttgcatagtccacagcaactagcagaagaggca
acccgcaaacgagaattaagacttatgaaaaatagggaagctgctaaagaatgtcgacgt
cgaaagaaagaatatgtaaaatgtctggagagtcgtgttgcagtgctggaagttcagaac
aagaagcttatagaggaacttgaaaccttgaaagacatttgctctcccaaaacagattag

DBGET integrated database retrieval system