KEGG   Monodelphis domestica (opossum): 100019885
Entry
100019885         CDS       T01031                                 

Gene name
CDX2
Definition
(RefSeq) caudal type homeobox 2
  KO
K22234  homeobox protein CDX2
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05226 Gastric cancer
    100019885 (CDX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdo03000]
    100019885 (CDX2)
Transcription factors [BR:mdo03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Cad
    100019885 (CDX2)
SSDB
Motif
Pfam: Caudal_act Homeodomain Homeobox_KN DUF1738 SUIM_assoc
Other DBs
NCBI-GeneID: 100019885
NCBI-ProteinID: XP_001367105
Ensembl: ENSMODG00000009021
UniProt: F7B348
Position
4
AA seq 302 aa
MYVSYLLDKDMSMYPSSVRHSSGLNLAPQNFVSPPQYPDYGGYHVAAANLDSAQSPGPSW
PSPYGAPLREDWNGYAPGATATTNSVAHGLNGGSPAAAMGYSSPADYHSHHHPHHHPHHP
GTAPSCASGLLQTLNPGPPVATAAEQLSPGGQRRNLCEWMRKPTQPSLGGQVKTRTKDKY
RVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKL
QQQQQQQQQQQQPPPQSQPQPGALRSGPEPLSPVASLQGSAPGSVPGVMGPAGGVLAPTI
TQ
NT seq 909 nt   +upstreamnt  +downstreamnt
atgtacgtgagctacctattggataaggacatgagcatgtaccccagctccgtgcgccat
tctagcgggctcaatttggcgccgcagaacttcgtcagccccccgcagtacccagactac
ggaggttaccacgtggcggctgcgaacttggacagcgcccagtccccgggcccctcctgg
ccctctccttacggcgctcctctccgggaggactggaatggctacgcgcctggagccacc
gccacaaccaattcagtggcgcacggtctcaatgggggttcccctgccgcagcaatggga
tacagcagcccggctgattaccactcacatcaccatccgcaccaccaccctcaccatcct
ggcactgcaccctcctgtgcctcggggctactgcaaacactcaaccccgggccgcctgtg
gccactgccgctgaacagctgtctccaggcggtcagcggcgcaacctgtgtgagtggatg
cggaaaccgacgcagccctccctgggcggccaggttaaaaccaggacaaaagacaaatac
cgagtggtgtacactgaccaccaacgtctggagctggagaaagagtttcactatagccga
tatatcactatccggaggaaagcggagctggctgctacactgggactatctgagagacag
gttaaaatctggtttcaaaaccgaagagccaaggaaagaaaaattaacaagaagaagttg
cagcagcagcaacagcagcagcagcagcagcagcagcctccacctcagtcacaaccccag
cctggtgctttgagaagtggcccagagccactgagtccagtagcctccctgcaaggctca
gcaccaggctctgtccctggagttatggggcctgctggaggagtgttggcccccaccatc
acacaatga

DBGET integrated database retrieval system