KEGG   Monodelphis domestica (opossum): 100020146
Entry
100020146         CDS       T01031                                 

Gene name
RFX7
Definition
(RefSeq) regulatory factor X7
Organism
mdo  Monodelphis domestica (opossum)
SSDB
Motif
Pfam: RFX5_N RFX_DNA_binding Pox_D5 Cdc6_C DUF4111
Other DBs
NCBI-GeneID: 100020146
NCBI-ProteinID: XP_001368345
Ensembl: ENSMODG00000008136
Position
1
AA seq 1455 aa
MAEEQQQPPPQQSDAHQQPTPCTPSPGVALPALVPGLPGTEARALQHKIKNSICKTVQSK
VDCILQEVEKFTDLEKLYLYLQLPSGLSNGEKSDQSSMSSSRAQQMHAFSWIRNTLEEHP
ETSLPKQEVYDEYKSYCDNLGYHPLSAADFGKIMKNVFPNMKARRLGTRGKSKYCYSGLR
KKAFVHMPTLPNLDFHKSGDGLEGAEPSGQLQTVDEEVISAACRLVCEWAQKVLSQPFDS
VLELARFLVKSHYIGTKSMAALTVMAAAPAGIKGISQPSAFIPTAESNSFQPQVKTLPSP
VDAKQQLQRKIQKKQQEQKLQSPLPGESPGKKPEGATTNGVTSISNGNPPILSPQPIGIV
VAAVPSPIPVPRTTRQLVTSPSPMGSSDGKVLPLNVQVVTQHMQSVKQAPKTPQNVPASP
GGDRSARHRYPQILPKPANTSALTIRSPTTVLFTSSPIKTVVPAPHMSSLNVVKMTAISL
TPSNSSAPLKHSPSVNSATGIEESRAVPPIKNGSVVSLQSPGSKTNSSVGTSSVEVKMEP
ENLLDENSVQCQENSDVSKAAKVTPRAPLGQRSNSEGTGLKPSSEGITETKTTKPCDQRT
KCKNRYNEMPPVTSGNNHSTVTLSVGAQNLPFTSTNSPSNGDPANKDTKLGTKSPRKRPS
ALQDSQVPPVKKPLVEQLSAGNIEAQKGSSSAKKDQKVLPATKAESLATGAQIPSKTMIN
VNSHVVANQSLSSNVVNASDSPLEQPMTSSSPDIKVKLEGNLFLLENDSKADSSFNSSDW
QQQITQDSEFSSASCEPQQGVSVMNITGHSDINDLEKSVWEPLHLDGMQLHNQIQESSLS
QMQAQSSNQLPLQSDLKEFEPTVSQTNENYFPFDDELTQDSIVEELVLMEQQMSMNNSHS
YGSCLGMTLQSQAVTAGTPLSSHPNNTHFYHSIHSNGTPIHTPTPTPTPTPTPTPTPTPT
SEMITGSQSLSRESPCSRLAQTTPVDSALGSSRHTPIGTPHSNCSSSVPPSPVECRNPFA
FTPISSSMAYHDASIISSSPVKPMQRPMATHPDKTKLEWMNNGYSGVSNSTVSSHGILPS
YQELVEDRFRKPHAFAVPGQSYQSQSRHHDTHFGRLTPVSPVQHQVTTVNNTNKQEGFAV
PAPLDNKGNNSSLNSSLRCRSVSPAVHRQRNLSGSTLYPVSNLPRSNLTPFGSPVTPEVH
NVFTNVHTDTSANNIAQRSQSVPLTVMMQTAFPTLQKQANSKKITNVLLSKLDSDNDDAV
RGLGINNLPSNYTARMNLTQILETSTAFPSANPQNMINSSTSVYEFQTPTYLTKNNSTDQ
INFSPGDNQAQSEIGEQQLDFSSTVKDLLGGDNLQANQQLVGQVASDLSNVASDFSSDIR
LSSELSGSINDLNTLDTNLLFDPGRQQGQDDDATLEELKNDPLFQQICNESMNPITSSGF
EWMESKDHPTVEMLG
NT seq 4368 nt   +upstreamnt  +downstreamnt
atggcagaggaacaacaacaaccaccaccacagcagtctgatgcccatcagcagcccacc
ccctgcactcccagcccgggggtggccctgccagccctggtgcccgggctgccggggacg
gaggcccgcgcactgcaacacaagatcaagaactccatctgtaaaactgtacaatctaaa
gtggactgcattttgcaagaagttgagaagtttacagacctagagaaactctacctctac
cttcagctgccttctggtctcagcaatggagagaaaagtgatcagagttccatgtcatct
agccgtgcccagcaaatgcatgccttttcctggatccgaaatacattggaggaacatcct
gagacttcactacctaagcaggaagtctatgatgaatataaaagctattgcgacaatctt
ggttaccatccattaagtgctgctgactttggaaagatcatgaaaaacgtctttccaaac
atgaaggcacgtcgcctgggcacaagaggcaaatcaaaatattgctacagtggactaagg
aaaaaagcttttgttcatatgccaacactgcccaaccttgactttcataaaagtggagat
gggttggaaggagccgaaccttccgggcaactccaaactgttgatgaggaagttatctct
gctgcctgccgccttgtgtgtgagtgggcccagaaagtattaagccaaccatttgattca
gtcttggaattagctcgcttccttgtaaaaagtcactacataggcaccaaatcgatggca
gctctaactgtaatggcagcagcaccagcaggaattaaaggaatctcccagccctctgct
tttatacccactgctgaaagcaattcctttcagcctcaagtgaagaccctgccctctcct
gttgatgctaagcagcagttacaacggaaaatccaaaagaaacaacaagaacagaagcta
caatctcccttaccaggagaatctccaggaaagaaaccagaaggagctactaccaatgga
gtaactagtatttctaatggaaatcctccaatcctttctccacagccaattggtattgtg
gtggcagctgttcccagtcctattccggtaccaagaaccaccaggcagttggtgacttcc
ccaagtccaatgggttcttcagatggcaaggtccttcctctcaatgtacaagtggtcacc
cagcacatgcagtctgtgaaacaggcaccaaagactcctcagaatgttccagccagtcca
ggtggtgatcgttctgctaggcaccggtatcctcagatcttacccaagccagccaacacc
agtgcgctcaccatacgctctccaactactgtcctctttacaagcagccccatcaaaact
gttgtgccagctccacatatgagttctctaaatgtggtaaaaatgacagcaatatcactc
acccccagcaacagtagtgcccctcttaaacattctccctctgtgaacagtgcaactgga
atagaagaatcaagggctgttcctcctatcaaaaatggttctgtcgtttcacttcagtct
cctggatctaagacaaatagttctgtgggaacttcttctgtggaagtaaaaatggaacca
gagaatttattagatgaaaattctgtacagtgccaagagaactctgatgtatctaaagct
gctaaagtgacccctcgtgcacctttggggcagagaagtaattcagagggtacaggattg
aaaccctcaagtgaaggtataactgaaacaaaaacaactaagccctgtgaccagaggacc
aaatgtaaaaatcgttacaatgaaatgccaccagtcacttcaggcaataatcacagtact
gtcactctctcagttggcgctcagaacttacccttcaccagcaccaattcaccatctaat
ggtgaccctgctaataaagacacaaagttaggcactaaaagtccgagaaagcgaccctct
gcattgcaagattcccaggtgcctcctgtaaagaaacccctggtggaacagctctctgca
ggtaacattgaagctcagaaaggaagtagcagtgctaaaaaagaccagaaagttctccct
gcaacaaaagcagagagcttagcaacaggtgctcagattcctagcaagacaatgataaat
gtaaattcacatgttgtggcaaaccagtccttaagttctaatgttgtaaatgccagtgat
tcgcctttagaacagccaatgacatcgtcatctccagatattaaagtgaaattagaagga
aatttgtttctcttagaaaatgactcaaaagcagatagcagctttaattccagtgactgg
cagcagcagatcactcaggattctgaattttcatctgccagctgcgaaccacagcaaggt
gtcagtgttatgaatattactggtcactctgacattaatgacttggagaagtctgtttgg
gagccattgcacttagatggaatgcagctacacaaccagatacaagaatcttctctgagt
caaatgcaagcacagtcttcaaatcagttacctctgcagtctgacctgaaggaatttgag
cccactgtttctcagacaaatgaaaactattttccatttgatgacgaacttacacaggat
agtattgtggaagagctagtgctcatggaacaacaaatgtcaatgaacaattcacattca
tatggtagctgtttaggaatgacacttcagagtcaagcagtaactgcaggaactccattg
tcatctcaccccaacaatacacacttctaccattcaatccatagcaatggcactccaatt
catacacctacaccaactccaacccccaccccaacacctactccaacaccaactccaacc
tctgagatgatcaccggctctcagagtttatcgagagagagcccctgctctaggctagcc
cagacaacaccagttgatagtgctttaggaagtagcagacatacaccgatcggtactcct
cactctaactgcagtagcagtgtccctcctagtcctgttgaatgcaggaatccgtttgca
tttaccccaataagctccagcatggcgtaccatgatgcaagcattatctcaagtagccct
gtgaaaccaatgcagagacctatggctactcaccctgacaaaaccaaacttgaatggatg
aataatgggtatagtggggtcagtaattcaacagtttcaagtcacggcattctcccaagc
tatcaggaactagtagaagatcgtttcaggaaacctcatgcttttgctgtgcctggccag
tcatatcaatctcaatccaggcatcatgatactcattttggtcgattgactcctgtctca
cccgtgcaacatcaagttaccactgtaaataataccaacaagcaagaaggctttgcagtt
cctgctcctcttgataacaaagggaataattcttccctcaacagcagcttgcgatgccgg
agtgtgagtcctgcagtccatcgtcaacgtaaccttagtggaagcaccctctatccggtt
tctaatctaccacgatctaatttgaccccttttggaagcccagtaactccagaagtccat
aatgttttcacaaatgtacacacagacaccagtgccaacaatatagctcaaagaagtcag
tcagtcccattgactgttatgatgcagacagccttccccactcttcagaaacaagcaaac
agtaaaaaaataaccaacgtgttgttgagtaaactcgattctgacaatgatgatgcagta
agaggtttgggaataaacaacctgccctccaattacacagcaaggatgaatctcactcag
atattagaaacttccactgcttttcctagtgccaacccacagaatatgatcaattccagc
acttcagtttatgaattccaaacaccaacttacctcacaaaaaacaacagcacggatcag
attaatttttcacctggagataaccaagcacaatcagaaattggagagcagcaattagat
ttcagtagcactgttaaagacctgttgggtggggacaacctgcaagccaaccagcaactg
gtgggtcaggtagcatcagatctcagtaatgtggcatctgatttctcgagcgatattagg
ttgtcttccgaactctcaggcagcatcaatgatttgaacactttagacacaaatctactg
tttgatccaggtcgccagcagggacaagatgatgatgctacactggaggaattaaagaat
gacccattatttcagcaaatctgcaatgaatccatgaaccctataacttcatcaggtttt
gagtggatggaaagcaaggaccatcccactgttgaaatgttgggttaa

DBGET integrated database retrieval system