KEGG   Monodelphis domestica (opossum): 100020585Help
Entry
100020585         CDS       T01031                                 

Gene name
MMP2
Definition
(RefSeq) matrix metallopeptidase 2
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01522  Endocrine resistance
mdo04670  Leukocyte transendothelial migration
mdo04912  GnRH signaling pathway
mdo04915  Estrogen signaling pathway
mdo04926  Relaxin signaling pathway
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo05200  Pathways in cancer
mdo05205  Proteoglycans in cancer
mdo05219  Bladder cancer
mdo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100020585 (MMP2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100020585 (MMP2)
   04915 Estrogen signaling pathway
    100020585 (MMP2)
   04926 Relaxin signaling pathway
    100020585 (MMP2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100020585 (MMP2)
   05205 Proteoglycans in cancer
    100020585 (MMP2)
  09162 Cancers: Specific types
   05219 Bladder cancer
    100020585 (MMP2)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100020585 (MMP2)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100020585 (MMP2)
  09176 Drug resistance: Antineoplastic
   01522 Endocrine resistance
    100020585 (MMP2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     100020585 (MMP2)
Peptidases [BR:mdo01002]
 Metallo Peptidases
  Family M10
   100020585 (MMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 100020585
NCBI-ProteinID: XP_001373030
Ensembl: ENSMODG00000013214
UniProt: F7EVX9
Position
1
AA seq 662 aa AA seqDB search
MMTPAAPGVLGFLLPVLWLHSSVFQQTWAAPSPIIKFPGDVSPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPETGELDQSTIETMKKPRCGNPDVANYNFFPRRPKWE
KNQITYRIIGYTPDLDPETVDDAFARAFKVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
DKEYNSCTDAGRSDGFLWCATSYNFDSDGKYGFCPHEALFTMGGNAEGQPCKFPFKFQGT
SYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKH
ESCTSAGRSDSKMWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGAL
MAPIYTYTKNFRLSNDDIKGIRELYGSSNDTGTDTGTGPTPTLGPVTPEICTKDIVFDGI
SQIRGEIFFFKDRFMWRMADSREKPTGPLLVATFWPEVPEKIDAVYESPQEEKAVFFSGN
EYWVYSASTLDRGYPKKLTSLGLPPDIQHVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKM
DPGFPKLIADSWNGIPDNLDAVVELQGSGHSYFFKDWYYLKLENKSLKIVKVGNIKSDWL
KC
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgatgactccggcggcccccggggtccttggattcctcctccctgtcctctggctccac
tccagcgttttccaacaaacttgggcagccccgtccccaatcatcaagtttccaggcgat
gtctctcccaaaacagacaaagagttggctgtacaatacctgaatacattctacggctgc
cccaaggagagctgcaacctgtttgtgttgaaggacaccctgaagaagatgcagaaattc
tttgggctaccagagacaggagagctggaccagagcactattgagaccatgaagaagcca
cgatgtgggaaccctgatgttgccaactataatttttttcctaggaggcccaaatgggag
aagaatcagatcacatacaggatcattggttacacacctgatctggaccctgagactgtg
gatgatgcttttgctcgagcctttaaggtctggagtgatgtgacaccccttaggttttca
cgtatccatgatggagaagctgacatcatgatcaactttggtcgctgggagcatggggat
gggtacccctttgatgggaaggatggactcctggctcatgccttcgctcctggcactggt
gtaggaggagactcccattttgatgatgatgagctatggaccttgggagaagggcaagtg
gtccgagtgaaatatgggaatgctgatggggaatactgtaagtttccattcctgttcaat
gacaaggaatacaatagttgcacggatgctggccgtagcgatggcttcctctggtgtgcg
acctcctacaactttgacagtgatgggaaatatggcttctgtccccatgaagccctgttt
accatgggtgggaatgctgagggccagccttgcaaattcccattcaagtttcagggcacc
tcttatgacagctgtactactgagggtcgaacagatggctaccgctggtgtggaactacc
gaagactatgatcgtgacaagaaatatggcttctgtcccgagaccgccatgtcaactgtt
ggtgggaactctgagggtgcaccctgtgtcttccccttcacgttcttgggcaacaaacat
gaatcctgtacaagtgctggccgaagtgatagcaaaatgtggtgtgccacaacaaccaat
tatgatgatgaccgaaagtggggcttttgccctgaccaaggttacagcctgttccttgtg
gcagcccatgagtttggtcatgctatggggctggagcactcagaagaccctggggcactg
atggcaccaatctacacatatactaagaatttccgcctgtccaatgatgatatcaaaggc
attcgggagctgtatgggtcctccaatgacactggcactgacactggtaccggccccacc
cccacactggggcctgtcactcctgagatttgcacaaaggacattgtgttcgatggcatc
tcacagattagaggagaaatattcttctttaaggacaggttcatgtggcggatggcagac
tcaagggagaagcccacagggcccctgcttgtagccacattctggccagaagttcctgag
aagatagatgcagtgtatgaatccccacaggaagaaaaggctgtgttcttctcagggaat
gagtactgggtctactctgctagcaccttggatcggggctatcctaagaagctgactagc
cttgggctgcctccagacattcaacatgtggatgctgcctttaactggagcaaaaacaag
aagacatatatttttgctggagacaagttctggaggtacaatgaagttaagaagaaaatg
gacccaggcttccccaagctcattgctgactcctggaatggcatccctgacaatctggat
gctgtggtagaattgcagggaagtggacacagctatttcttcaaggactggtattacctt
aaactggagaacaagagtctgaaaattgtgaaagttggaaacatcaaatcggactggctg
aagtgctga

DBGET integrated database retrieval system