KEGG   Monodelphis domestica (gray short-tailed opossum): 100020699
Entry
100020699         CDS       T01031                                 
Symbol
SLC18A2
Name
(RefSeq) solute carrier family 18 member A2
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
mdo  Monodelphis domestica (gray short-tailed opossum)
Pathway
mdo04721  Synaptic vesicle cycle
mdo04726  Serotonergic synapse
mdo04728  Dopaminergic synapse
mdo05012  Parkinson disease
mdo05030  Cocaine addiction
mdo05031  Amphetamine addiction
mdo05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100020699 (SLC18A2)
   04726 Serotonergic synapse
    100020699 (SLC18A2)
   04721 Synaptic vesicle cycle
    100020699 (SLC18A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100020699 (SLC18A2)
  09165 Substance dependence
   05030 Cocaine addiction
    100020699 (SLC18A2)
   05031 Amphetamine addiction
    100020699 (SLC18A2)
   05034 Alcoholism
    100020699 (SLC18A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mdo02000]
    100020699 (SLC18A2)
Transporters [BR:mdo02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   100020699 (SLC18A2)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    100020699 (SLC18A2)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 100020699
NCBI-ProteinID: XP_001368111
Ensembl: ENSMODG00000009424
UniProt: F7BLF1
Position
1:complement(92623424..92740457)
AA seq 514 aa
MALGEFGLLTWLRESRQSKKLILFIVCLALLLDNMLLTVVVPIIPSYLYSMKHEKNATEI
QTAKPETGSPTFSSIFSYYDNSTMVTGNVIKAPEKEQSYKTVTQQMVVNATSIPSDCPKE
EKDLINENVQVGLLFASKATIQLLTNPFIGPMTNRIGYQIPMFAGFCIMFVSTVMFAFSR
SYALLLIARSLQGVGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLALGVLVGPPFGS
VMYEFVGKTAPFLVLAALTLLDGAIQLFVFQPSKIQPESQKGTSLVTLLKDPYILIAAGS
ICFANMAIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC
ALLGMIIVGISVLCVPLARNIYGLIAPNFGIGFAIGMVDSSMMPIMGYLVDLRHVSVYGS
VYAIADVAFCMGYALGPSVGGAIAKAIGFPWLMTIIGIIDIIFAPLCFFLRSPPAKEEKM
AILMDHNCPIKTKMYTQNNIQAYPTVDVEESESD
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggctctgggtgaatttggtctcctcacctggcttcgggaaagccggcagtcgaagaaa
ttaatcctttttatcgtatgccttgctctcctcctggacaatatgcttcttactgttgtg
gtgcccatcattcccagttatttatactccatgaagcatgaaaaaaatgccacagaaata
caaactgccaaaccagaaactgggtctcccaccttcagcagcatcttctcctattatgac
aattccacaatggtcactggaaatgtcattaaagcacctgaaaaagaacagtcatataag
acagtgacacagcaaatggtagtcaatgcaaccagcatcccatctgactgccccaaggaa
gaaaaagacctgatcaatgaaaacgttcaagttggcttattatttgcttccaaagctacc
atccagctcctcactaaccctttcatagggccaatgactaacagaataggctaccagatc
ccaatgtttgcaggattctgtatcatgtttgtgtccactgtcatgtttgctttttctagg
agttacgcattactcctcatagcaagatccttgcaaggagtgggttcttcttgttcttcc
gtagctgggatgggtatgctggccagcgtttacacggatgatgaagaaagaggcaatgcc
atgggaattgccttgggaggacttgctttgggagtgctagtgggaccaccctttgggagt
gtgatgtatgaatttgtggggaagactgcgcctttcttggttctggctgccttaactctg
ctggatggagctattcaactgtttgttttccaaccatccaagattcaaccagaaagtcag
aaaggaacctcgctggtcactctgttgaaggatccttacatcttgatcgctgcagggtcg
atctgctttgcaaacatggctattgcaatgcttgagccagcattaccgatctggatgatg
gagaccatgtgttccagaaaatggcagctgggcgttgctttcctaccagctagtatctct
tatcttattggaaccaatatttttgggatacttgcgcacaaaatgggaaggtggctttgt
gctctcttggggatgatcattgttggaatcagcgttttatgtgtaccacttgcaagaaac
atttatggactgatcgcaccaaattttggaattggttttgcgattgggatggtggattcc
tcaatgatgcccattatgggctatttggtagatctgcgccatgtctccgtctacgggagt
gtgtatgccattgcagatgttgccttttgcatggggtatgcattaggcccttctgtcggt
ggggccatcgcaaaagcaattggattcccatggctcatgacaattattgggatcattgat
attatctttgcccctctgtgctttttccttcgaagtccacctgccaaggaagaaaaaatg
gcaatactcatggatcacaactgcccaatcaaaacaaaaatgtacacacagaacaacatt
caggcatatccaacagttgatgttgaagaatctgaaagtgactga

DBGET integrated database retrieval system