KEGG   Monodelphis domestica (opossum): 100022006Help
Entry
100022006         CDS       T01031                                 

Gene name
SEPT7
Definition
(RefSeq) septin 7
  KO
K16944  septin 7
Organism
mdo  Monodelphis domestica (opossum)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mdo04131]
    100022006 (SEPT7)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mdo04812]
    100022006 (SEPT7)
   04147 Exosome [BR:mdo04147]
    100022006 (SEPT7)
Membrane trafficking [BR:mdo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    100022006 (SEPT7)
Cytoskeleton proteins [BR:mdo04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     100022006 (SEPT7)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100022006 (SEPT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 FeoB_N AAA_16 AAA_22 Ras AAA_7 AAA_29 ABC_tran Roc Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 100022006
NCBI-ProteinID: XP_007500728
Ensembl: ENSMODG00000021167
Position
6
AA seq 429 aa AA seqDB search
MLLIGYISRRFIAAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLIN
SLFLTDLYSSEYPGPSHRIKKTVQVEQAKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQ
PVIDYIDSKFEDYLNAESRVNRRQMPDSRVQCCLYFIAPSGHGLKPLDIEFMKRLHDKVN
VIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAV
VGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTSNVHYEN
YRSRKLAAVTYNSVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEK
VQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDDKANWEAQQRILEQQNTSRTLE
KNKKKGKIF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgattgggtatatatctagaaggtttattgcagctcaacagaagaaccttgaa
ggctatgtgggatttgcgaatctcccaaatcaagtataccgaaaatctgtgaagagaggg
tttgaattcacgcttatggtagtaggagaatctggattggggaagtcaacgttaatcaac
tcattattcctaacagacttgtattcttcagagtacccagggccttcacatagaattaaa
aagaccgtacaggtggaacaagcaaaagttttaatcaaagaaggtggtgtgcagctgctg
ctcacaatagtggatacgcctgggttcggtgatgcagtggacaatagtaattgttggcag
cctgttatcgactacattgacagtaaatttgaggattatctgaacgcagaatctcgggtg
aacagacggcagatgccagacagcagggtgcaatgttgtttatacttcattgccccttca
ggccatggcctcaagcctctggacatcgagttcatgaaacgcttgcatgacaaggtgaac
gtcattccgctcattgccaaagcggacacactgactcctgaggaatgccagcagtttaag
aagcagataatgaaagaaattcaagagcataaaataaaaatatacgagtttccagaaaca
gatgatgaagaagaaaataagcttgttaaaaagataaaggaccgtttgcctcttgctgtg
gttggtagcaatactatcattgaagttaatggcaaaagggttcgaggaagacagtatcct
tggggtgttgcagaagttgaaaatggtgaacattgcgattttacaattctaagaaacatg
ttgataagaacccacatgcaggacctgaaggacgtgacgagcaacgtgcactacgagaac
tacaggagccggaagctggcagctgtgacgtacaatagtgtagataacaacaagaacaaa
gggcagctgaccaagagccctctggcccaaatggaggaagaaagaagggagcatgtagcg
aagatgaagaagatggagatggagatggagcaagtgttcgagatgaaggtcaaagaaaag
gttcagaagctcaaggactcggaagccgagctgcagcggcgtcatgagcagatgaagaag
aacctggaagcccagcacaaggaactggaggagaagcggcgccagtttgaggatgacaaa
gccaactgggaagctcagcagcggatcttggagcaacaaaacacttccagaactttggaa
aagaacaagaagaaagggaagatcttttaa

DBGET integrated database retrieval system