KEGG   Monodelphis domestica (opossum): 100022488Help
Entry
100022488         CDS       T01031                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00562  Inositol phosphate metabolism
mdo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100022488 (MINPP1)
   00562 Inositol phosphate metabolism
    100022488 (MINPP1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100022488 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100022488 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 100022488
NCBI-ProteinID: XP_001374318
Ensembl: ENSMODG00000016492
UniProt: F6YPV7
Position
1
AA seq 473 aa AA seqDB search
MLSLRKRLRWRRPWGLGVPGVAALLACAAACALAERAPACRAAGLSPYFGTKSRYEDVAR
PAPGPAPELGSCVPLQLVAVVRHGTRYPTAKQVGRLRSLHGLLLRAGPPGPGLASALARW
PLAYEDWMDGQLVDKGNQDMRQLATRLATRFPTLLGRAGPASVRFVTSSKPRCVDSASAF
AQGLWEQLHPERPAPDPADMEWGPPRVNDKLMRFFDHCEKFLVEVEKNDSALYHVEAFKN
GPEMQKIIKKVAAILQVPASDLNADLIQVAFFSCSFDLAIRDIQSPWCDVFDTEDAKVLE
YLNDLKQYWKRGHGYAINSRSSCTLFNDIFRHLDEAMEQRQKSQPISSPAIFHFGHAETL
LPLLSLMGYFKDKEPLTAYNYREQTGRQFRSGHIVPYASNLIFVLYHCERAETPAGQYQV
QLLLNERPLPFVHSPDTVTAYQDLKDHYRDILQSCRSDQECALPGINITSDEL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctctcgctgaggaagcggctgcggtggcggcggccttgggggctcggggtcccgggg
gtcgccgccttgctggcgtgcgcggcggcctgcgccctggcggagcgggcgcccgcgtgc
cgggcggcggggctgagcccgtatttcggtactaagagtcgctacgaggacgtggcgagg
ccggcgccggggcccgcgccggagctggggtcgtgcgtgccgctgcagctcgtggccgtg
gtgcgccacggcacccgctaccctacagctaagcaggtgggccgcctgcgctcgctgcac
ggactgctcttgcgagcgggaccgccggggccagggctggcgagcgcgctggcgcgctgg
ccgctggcctacgaagactggatggacgggcagctggtagacaagggcaaccaagacatg
cggcagctggccacccgcctagccacgcgcttccccacgcttctcggccgtgccggccca
gccagcgtgcgcttcgtcactagttcaaagccacgctgcgtggacagcgcctccgcgttc
gcgcagggcctctgggagcagctgcaccctgagcgcccggcgcccgatcccgcagatatg
gagtggggaccacctagggtaaatgataaactaatgaggttctttgatcattgtgaaaag
ttcctagtggaggtggaaaagaatgattcagctctttatcatgtagaagccttcaaaaat
ggaccagaaatgcagaaaattataaagaaagttgcagctattttgcaggtgccagcaagt
gatttaaatgcagatttaattcaagttgcctttttttcctgctcatttgacttggctatt
agagacattcagtctccctggtgtgatgtctttgacacagaagatgctaaggtactggaa
tacctcaatgacctgaagcaatattggaaaagagggcatggctatgcaatcaacagccgg
tccagctgtaccctgtttaacgatatatttcggcatttggatgaagctatggaacagagg
caaaagtctcagcccatctcttctccagccatcttccacttcggccacgcggagacgctg
ctgccgctgctctccctcatgggctactttaaggacaaggagcccctgaccgcgtacaat
tacagggagcagacgggccgccagttccggagcggccacatcgtgccctacgcgtccaac
ctcatctttgtgctctaccattgcgagcgggccgagacgcccgccgggcagtaccaggtg
cagctgctgctgaacgagaggccgctgcctttcgtccactcgccggacaccgtgacggcc
tatcaggacctgaaggaccactacagggacatcctgcagagctgccgctcggaccaggag
tgcgccctgcccggcatcaacatcacttcggacgagctgtga

DBGET integrated database retrieval system